KEGG   Dehalogenimonas lykanthroporepellens: Dehly_0962Help
Entry
Dehly_0962        CDS       T01264                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
dly  Dehalogenimonas lykanthroporepellens
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dly00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Dehly_0962
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dehly_0962
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Dehly_0962
Enzymes [BR:dly01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Dehly_0962
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
959206..960258
Genome map
AA seq 350 aa AA seqDB search
MKSGVLERYRAFLPVTDNTPALTLGEGDTPLVRSPGLERATGVGELYFKLEGCNPTGSFK
DRGMVMAVAKALEDGFKAVACASTGNTSASATAYASAAGVESIIIIPKGKIALGKLAQAI
VYGARIVMVDGNFDDALRLVREMTETRPVALVNSVNPYRIEGQKTAAFEICDVLGGAPDR
LFLPVGNAGNITAYWKGFKEYHDKGITDRTPMMMGFQAAGAAPIVLGAPVTRPETIATAI
RIGNPASWKQAEAARDESGGVIDMVTDDEILRAYHLMAEKGGIFGEPASAAPLAGLLKLK
AQGYDFSKERIVCVVTGNGLKDADTAIKGFSGEFIEIPPDPASVEKALGW
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcaggcgtactggaacgataccgagcgtttctgccggtcaccgataacaccccg
gctctgactctgggcgaaggcgataccccgctggtgcgctcacccggactggagcgggct
accggcgtcggcgagttgtatttcaaattggaaggctgtaaccccaccggctcattcaaa
gaccgcggcatggtcatggcggtggccaaagcgctggaagacggcttcaaggcggtggcc
tgcgcttctaccggcaacacttcggcttcagccaccgcctacgcctccgccgccggtgtc
gagtccatcatcatcattcccaagggcaagatagccctgggcaagctggcacaggccatc
gtgtacggcgcccgcatcgtcatggtggacggcaatttcgatgacgccctgcgcctggtg
agggagatgaccgagacccgcccggtggcgctggtcaattcggtcaatccctatcgcatc
gaggggcagaaaacagccgcatttgaaatctgtgacgtactgggcggcgctcctgaccgg
ctgtttctgccggtaggcaacgccggcaatatcaccgcctactggaagggtttcaaggaa
taccacgataaaggcatcaccgaccggacccccatgatgatgggctttcaggccgccggc
gccgcgccgatagtgctgggcgccccggttacccggccggaaaccatcgccaccgccatc
cgtatcggcaacccggcctcatggaaacaggccgaagccgcccgggacgaatccggcggc
gtcatcgacatggtaaccgatgatgaaatactgagagcctatcacctgatggccgaaaaa
ggcggcatcttcggtgagccggcttctgccgccccgctggctggactgctcaaactgaag
gcccagggatacgacttcagcaaggagcggatagtctgtgtcgtcaccggcaacggcctc
aaggatgccgacaccgccatcaagggcttctccggcgagttcattgaaatcccaccggat
ccggcctcggtggaaaaagcactgggctggtag

DBGET integrated database retrieval system