KEGG   Dehalogenimonas lykanthroporepellens: Dehly_0964Help
Entry
Dehly_0964        CDS       T01264                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
dly  Dehalogenimonas lykanthroporepellens
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dly00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Dehly_0964
Enzymes [BR:dly01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Dehly_0964
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
960866..961426
Genome map
AA seq 186 aa AA seqDB search
MIDENAIAAAVETMLEAIGDDPNREGLRDTPERVARMYAEIFSGIDKNPADDLKVGYELG
HREMVILKDIPFYSMCEHHLLPFSGVVHIGYVPGQDGRVVGISKLARVVETVARRPQIQE
RMATEIADAIVDGLSPDGVGVVITAEHMCMTMRGIKKPGSKVLTSALRGGFAKRPATRAE
FMSLIQ
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgatagacgaaaacgccattgccgcggcggtggaaacaatgcttgaagccatcggcgac
gatcccaaccgggaaggtctgcgcgacaccccggaacgcgtcgcccgcatgtacgctgaa
atattctccggtatcgacaagaaccccgctgacgacctcaaggtcggctacgagctgggc
caccgggaaatggtcatcctgaaggacatccccttctattccatgtgcgaacaccacctg
ctccccttctccggcgtggtgcatatcggctatgttcccggccaggacggccgggtggtc
ggtatctccaagctggcccgagtggtggaaaccgtcgcccgccggccgcagattcaggag
cgcatggccaccgaaatcgccgatgccatagtggacggcctgagccccgacggtgtcggc
gtagtcatcaccgccgaacacatgtgcatgaccatgcgcggcattaaaaaaccgggctcc
aaagtccttacctccgccttacgcggcggcttcgccaaacgccctgccactcgcgctgag
ttcatgtcgctgattcagtag

DBGET integrated database retrieval system