KEGG   Dehalogenimonas lykanthroporepellens: Dehly_1002Help
Entry
Dehly_1002        CDS       T01264                                 

Definition
(GenBank) acetate/CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
dly  Dehalogenimonas lykanthroporepellens
Pathway
dly00010  Glycolysis / Gluconeogenesis
dly00620  Pyruvate metabolism
dly00640  Propanoate metabolism
dly00680  Methane metabolism
dly01100  Metabolic pathways
dly01110  Biosynthesis of secondary metabolites
dly01120  Microbial metabolism in diverse environments
dly01130  Biosynthesis of antibiotics
dly01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dly00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dehly_1002
   00620 Pyruvate metabolism
    Dehly_1002
   00640 Propanoate metabolism
    Dehly_1002
  Energy metabolism
   00680 Methane metabolism
    Dehly_1002
Enzymes [BR:dly01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Dehly_1002
Lipid biosynthesis proteins [BR:dly01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Dehly_1002
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding ACAS_N AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ADJ26303
UniProt: D8K125
Position
complement(999028..1001010)
Genome map
AA seq 660 aa AA seqDB search
MTQTDSRVTHLPTGSYYNPTGEYDEMYRRSLEDPEGFWAEQAESLDWFKPWEKVLDWKAP
YARWFVGGKLNLSYQCLDRHMKTETRNKVAFYWEGELGDSQVLTYHEMYRLTNNYAAALK
RLGVNRGDKVALYLPMIPALPVFMLACARIGAIFTVVFSAFSGQALADRVEDVNAKVIIT
ASGMHRRGKILPLKDNAVEAAGKCPCVEKIVVVKHTGHHTEMDPKRDVWLDDILSDTDEY
VAPEEMDSNDPLFVLYTSGSTGKPKGILHGTAGYSLWIAKTLQWAFNPGKESVFWCTADI
GWITGHSYVVFAPLELGLTSVMYEGAPDYPGIDRWWQLIAKYGVTIFYTSPTAIRMFMRH
GEEWPAKYDLSSLKSLGSVGEPINPEAWLWYYRNIGHERIPISDTWWQTETGGFMISPTP
GIQPHPLKPGSATKPMPGVDVAVLDPDGKELPNGQTGFIVIRKPWPGMLLDIYNNQELYE
KTYWSRFPGNYLPGDFCMRDQDNFLWLLGRADEVIKVAGHRISTAELESSIVGHSAVAEA
AACSRPDEVKGEAIILFVTLRKGTDPSPEIKAELTRHLRATIGALATPEEIFFVNLLPKT
RSGKIMRRLLKAVATGATVGDTSTLDDGASIDEARAAFDELKNSAQRYKTAEKKPDIKGD
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgacacagacagattcccgcgtgacccatctacccaccggcagttattacaaccccacc
ggcgagtacgacgaaatgtaccgtcgttccctcgaggatcctgaagggttctgggcggag
caggcggaaagcctggactggttcaagccctgggagaaggtgctggattggaaggccccc
tatgcccgctggttcgtcggtggcaaactgaacctgtcctatcagtgcctggaccggcat
atgaagaccgagaccagaaataaagtagctttctattgggaaggcgagctgggtgattcc
caggtgctgacctaccatgaaatgtaccgattgaccaataactacgccgcggcgctcaag
cggctgggggtgaacaggggcgataaagtggccctgtatctgccgatgattccggcactc
ccggtgttcatgctggcctgcgctcgcatcggggccatttttaccgtggtattctccgcc
ttctccggtcaggcgctggccgaccgggtcgaggatgtgaatgccaaagtcattatcacc
gcttccggaatgcatcgccgcggcaagatactgccattgaaagataacgcggtcgaggcc
gccggcaagtgtccctgtgtcgagaagatcgtggtggtcaagcataccggtcaccatacc
gaaatggaccccaagcgcgatgtctggctggacgatattctgtccgataccgatgaatat
gtcgctccggaagagatggattccaatgacccgctgttcgtcctttatacctcaggcagt
accggcaagcccaagggtattctgcatggcaccgccggttattccctatggatagccaag
acactgcaatgggccttcaatcccggcaaagagagtgtcttctggtgcaccgccgatatc
ggctggattaccggtcacagctatgtggtgttcgcgccgctggagctgggtttgacttcg
gtgatgtatgaaggagcgccggattatccgggtatcgaccgctggtggcagttgattgcc
aaatacggcgtgactattttctatacctctcccactgccatccggatgttcatgcggcac
ggtgaggaatggccggccaagtatgacctgtccagcttaaagtcgctgggttcggtcggc
gagccgatcaacccggaagcctggttgtggtactaccgtaatatcggccacgaacggatt
cccatctccgacacctggtggcagacggagaccggcgggttcatgatttcgccgaccccc
ggcatccagcctcatccgttgaaacccggttcggccaccaaaccgatgcccggtgtggat
gtagcggtgctggatcccgacggcaaggaactgcctaacggccagaccggctttattgtc
atccggaagccgtggcccggtatgttactggacatctataacaaccaggaactttacgag
aaaacctattggtcccgtttcccaggtaattatctgcccggcgacttctgcatgagggac
caggacaatttcctgtggttgctgggccgggctgacgaggtcatcaaggtagccggccat
cggatttccaccgctgaactggaaagctctatcgttggccactccgcggtggccgaggcg
gcggcctgttcccggcctgatgaggtcaagggcgaagctatcattctgttcgtgacgttg
cgcaagggcaccgacccgtcaccggaaatcaaggccgagctgacgcgtcatctgcgggcg
accatcggcgcgctggccacgccggaagagatattcttcgtcaaccttttgccgaagacc
cgttccggcaagatcatgcggcgtctgctgaaggcggtggctaccggagcgaccgtcggc
gatacctcgacgctggatgacggcgcttccatcgacgaagccagggcggccttcgacgaa
ctcaaaaacagcgcacagcgctacaagaccgccgagaaaaaacccgatatcaagggtgat
tag

DBGET integrated database retrieval system