KEGG   Dehalogenimonas lykanthroporepellens: Dehly_1005Help
Entry
Dehly_1005        CDS       T01264                                 

Definition
hypothetical protein
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
dly  Dehalogenimonas lykanthroporepellens
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dly00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dehly_1005
   01230 Biosynthesis of amino acids
    Dehly_1005
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dehly_1005
   00030 Pentose phosphate pathway
    Dehly_1005
   00051 Fructose and mannose metabolism
    Dehly_1005
  Energy metabolism
   00680 Methane metabolism
    Dehly_1005
Enzymes [BR:dly01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Dehly_1005
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Dehly_1005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1002941..1004035)
Genome map
AA seq 364 aa AA seqDB search
MKITLSVIKADIGGYVGHSDAHPECVCTADDALAKAKKSGLLIDYHTTKCGDDLQLIMTH
QRGENNADIHEMAWNTFVACTEVAKKHKLYGAGQDLLTDAFSGNIKGMGPGAAEMEFEER
TSEPVVVFMADKTSSGAWNLPLYKMFADPFNTIGLVIAENMHQGFKFEVHDVKESKKITF
KTPEEIYDMLVFIGAANRYPIKSVYTLSGEIAASSSTQKLAFLAGRYVGKDDPVCIVRCQ
GSFPAVGEVLEPFAKPYLVEGWMRGSHYGPLMPVSVADSLPTRFDGPPRVTALGFQLAEG
RLVGPRDFFADVSYDQARQKANDMAYMMREHGPFEPHRLPLDEMEYTTMPQVSRKLEGRF
EPIE
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgaagattactctgagcgtaatcaaggccgatatcggtggctatgtaggtcattcggat
gcccatccggagtgcgtctgtaccgctgacgacgctctggccaaggccaagaaaagtggt
ctgttgatagattatcacaccaccaagtgcggtgacgatctgcaacttatcatgacccat
cagcggggagagaacaatgccgatatccacgagatggcgtggaataccttcgttgcctgc
accgaagtggccaagaaacataaactctatggcgccggccaggacctgctgaccgatgcc
ttttccggcaatatcaaaggcatggggccgggcgcggccgaaatggagttcgaggaacga
acgtccgagccggtagtggtgttcatggctgacaagacatcatcgggtgcctggaacctc
ccgctgtacaagatgtttgccgatccatttaataccatcggtttggtaatcgccgagaac
atgcaccagggtttcaagtttgaggtgcatgacgtcaaggaaagcaaaaagatcaccttc
aagactccggaagagatatacgatatgctggtctttatcggcgcggccaaccgctatccc
atcaagtcagtctataccctgagtggagagatcgccgcctcgtcttccacccagaagctg
gcgtttctggccggccggtatgtcggcaaggatgacccggtgtgcatcgtccgctgtcag
ggttcctttccggcggtcggcgaagtcctggagccgttcgccaagccgtacctggtggaa
ggctggatgcgcggctcgcattacggcccgctgatgccggtgagcgttgccgacagtctg
ccgacccgtttcgacgggccgccaagggtaaccgccctgggcttccagctggcggagggc
cggctggtggggccgcgggatttctttgctgacgtgtcctacgatcaggctcgccagaag
gccaacgatatggcttacatgatgcgggaacatggcccgttcgaaccgcaccggttgccg
ctggatgagatggaatacaccaccatgccccaggtgtcgcgtaaactggaagggcgtttc
gagccaatcgagtaa

DBGET integrated database retrieval system