KEGG   Dehalogenimonas lykanthroporepellens: Dehly_1316Help
Entry
Dehly_1316        CDS       T01264                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
dly  Dehalogenimonas lykanthroporepellens
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:dly00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:dly00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:dly02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1296921..1298321
Genome map
AA seq 466 aa AA seqDB search
MKTKKHMFRLMVTALSVTAILLTSVTGVSAKTEIKKNDANLPKNIIVMIADGWGYNQVLS
TNYYQGVNKQSYELFPVKAGMSHYEVEKSNGEPIIYGYDPVAMWSDFDYAKQNATDSASS
GTAIASGEKTFSGMIGWSIDGEPIYLITELAEELGKSTGVVTSVQISHATPASFVAHNAS
RNNYSDIANEMILSSATDVIMGAGNPYFDNDGNELSSGNFRYIGGESTWEGLLAGTIGND
ANGDGSVDYWNLIQDKDDFQSLMTGETPGRIIGIAQVATTLQQSRSGNGSADPCTVPFND
NVPTLAEMSVGALNVLDADPDGFFLMIEGGAVDWAGHDNQSGRLIEEMTDYNTAVEAVIN
YLKANKLWDDTLLIVTGDHETGYLWGPDSGATDNGPVWNPIVNNGAGNLPGMAWYSGDHT
NQLIPFFATGKGHQLVRAYLDETDPVRGKYLDNSNIGKLMFDIWDR
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaacaaaaaagcatatgttccggttgatggtaacggcactgagcgttaccgccatt
ctgctgacatcggttaccggcgtcagcgccaagaccgaaatcaagaaaaacgacgccaat
ctgccaaaaaatatcattgtcatgatagccgacggctggggctataaccaggtgctatcc
accaactactaccagggcgtcaacaaacaaagctatgaactgttcccggtcaaggccggc
atgagccactacgaagtggagaaaagcaacggcgaacccatcatctacggctacgacccg
gtcgccatgtggagcgatttcgactacgccaaacagaacgccaccgattcggcctcgtcg
ggtacggccatcgcctcaggtgaaaagaccttcagcggcatgatcggctggagcatcgac
ggcgagccgatctacctgataaccgaactggccgaggagttgggcaaatctaccggcgta
gtcacttcggtacagatttcgcacgccactccggcttccttcgtggctcacaacgcttcc
cgcaataactattctgacattgccaacgagatgatcctatccagcgccaccgacgtcatc
atgggtgccggcaatccctacttcgataatgacggaaatgagctatcatccggcaatttc
agatatatcggcggcgaaagcacctgggaggggctgttggctggcaccatcggcaacgac
gccaacggtgacggtagcgtcgattactggaatctcatccaggacaaggacgacttccag
tccttaatgaccggtgaaaccccgggacggatcatcggcatcgcccaggtagctactacc
ctgcaacagtcccgctccggcaacggctccgccgacccctgcaccgttcctttcaacgac
aacgtaccgacgctggccgagatgtcggtcggcgcgctgaacgtactcgacgccgacccg
gacggcttcttcctgatgatcgagggcggcgctgtcgactgggccggacacgataaccag
tcaggtcggctgatagaggaaatgaccgactacaacacggcggtcgaggccgtcatcaat
tacctgaaggccaacaaactctgggatgacaccctgctcatcgtaaccggcgaccacgaa
accggctacctatggggtcccgattccggggcaaccgataatggtccggtctggaatcca
atcgtcaataacggcgccggcaatctcccaggcatggcctggtattcaggagaccatacc
aatcagctcattcctttcttcgccaccggcaagggacaccagctggtgagagcctacctc
gatgaaaccgacccggtacgcggcaaatatctggacaatagcaacatcggtaagctgatg
ttcgatatctgggatcgctaa

DBGET integrated database retrieval system