KEGG   Dehalogenimonas lykanthroporepellens: Dehly_1316Help
Entry
Dehly_1316        CDS       T01264                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
dly  Dehalogenimonas lykanthroporepellens
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:dly00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Dehly_1316
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Dehly_1316
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Dehly_1316
Enzymes [BR:dly01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Dehly_1316
Exosome [BR:dly04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dehly_1316
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1296921..1298321
Genome map
AA seq 466 aa AA seqDB search
MKTKKHMFRLMVTALSVTAILLTSVTGVSAKTEIKKNDANLPKNIIVMIADGWGYNQVLS
TNYYQGVNKQSYELFPVKAGMSHYEVEKSNGEPIIYGYDPVAMWSDFDYAKQNATDSASS
GTAIASGEKTFSGMIGWSIDGEPIYLITELAEELGKSTGVVTSVQISHATPASFVAHNAS
RNNYSDIANEMILSSATDVIMGAGNPYFDNDGNELSSGNFRYIGGESTWEGLLAGTIGND
ANGDGSVDYWNLIQDKDDFQSLMTGETPGRIIGIAQVATTLQQSRSGNGSADPCTVPFND
NVPTLAEMSVGALNVLDADPDGFFLMIEGGAVDWAGHDNQSGRLIEEMTDYNTAVEAVIN
YLKANKLWDDTLLIVTGDHETGYLWGPDSGATDNGPVWNPIVNNGAGNLPGMAWYSGDHT
NQLIPFFATGKGHQLVRAYLDETDPVRGKYLDNSNIGKLMFDIWDR
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaacaaaaaagcatatgttccggttgatggtaacggcactgagcgttaccgccatt
ctgctgacatcggttaccggcgtcagcgccaagaccgaaatcaagaaaaacgacgccaat
ctgccaaaaaatatcattgtcatgatagccgacggctggggctataaccaggtgctatcc
accaactactaccagggcgtcaacaaacaaagctatgaactgttcccggtcaaggccggc
atgagccactacgaagtggagaaaagcaacggcgaacccatcatctacggctacgacccg
gtcgccatgtggagcgatttcgactacgccaaacagaacgccaccgattcggcctcgtcg
ggtacggccatcgcctcaggtgaaaagaccttcagcggcatgatcggctggagcatcgac
ggcgagccgatctacctgataaccgaactggccgaggagttgggcaaatctaccggcgta
gtcacttcggtacagatttcgcacgccactccggcttccttcgtggctcacaacgcttcc
cgcaataactattctgacattgccaacgagatgatcctatccagcgccaccgacgtcatc
atgggtgccggcaatccctacttcgataatgacggaaatgagctatcatccggcaatttc
agatatatcggcggcgaaagcacctgggaggggctgttggctggcaccatcggcaacgac
gccaacggtgacggtagcgtcgattactggaatctcatccaggacaaggacgacttccag
tccttaatgaccggtgaaaccccgggacggatcatcggcatcgcccaggtagctactacc
ctgcaacagtcccgctccggcaacggctccgccgacccctgcaccgttcctttcaacgac
aacgtaccgacgctggccgagatgtcggtcggcgcgctgaacgtactcgacgccgacccg
gacggcttcttcctgatgatcgagggcggcgctgtcgactgggccggacacgataaccag
tcaggtcggctgatagaggaaatgaccgactacaacacggcggtcgaggccgtcatcaat
tacctgaaggccaacaaactctgggatgacaccctgctcatcgtaaccggcgaccacgaa
accggctacctatggggtcccgattccggggcaaccgataatggtccggtctggaatcca
atcgtcaataacggcgccggcaatctcccaggcatggcctggtattcaggagaccatacc
aatcagctcattcctttcttcgccaccggcaagggacaccagctggtgagagcctacctc
gatgaaaccgacccggtacgcggcaaatatctggacaatagcaacatcggtaagctgatg
ttcgatatctgggatcgctaa

DBGET integrated database retrieval system