KEGG   Dehalogenimonas lykanthroporepellens: Dehly_1365Help
Entry
Dehly_1365        CDS       T01264                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
dly  Dehalogenimonas lykanthroporepellens
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dly00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dehly_1365
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dehly_1365
   00052 Galactose metabolism
    Dehly_1365
   00500 Starch and sucrose metabolism
    Dehly_1365
   00520 Amino sugar and nucleotide sugar metabolism
    Dehly_1365
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Dehly_1365
   00524 Butirosin and neomycin biosynthesis
    Dehly_1365
Enzymes [BR:dly01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Dehly_1365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1342133..1343083
Genome map
AA seq 316 aa AA seqDB search
MKNAAPILVADLGGTKVLAGAVGEGNRLEYRVRRGSAGAGSQDEILTNLYGALTEVAAAM
PEPPQAVAVASAGAIDLAAGVVTHSPNMMAVNGLPLRTMISEKYGLPTVLLNDASAAALA
EHRLGAGRGCRDMIFLTVSTGIGGGIIIDGRLYQGIDGTAGEFGHTVIDRHGEPDTCGAR
GCLEQYASGTAIARRAKQLLDAGRRSELEAGRDRLSAADVADAAARGDALATEVFDEALQ
ALGLGLVSIVNVFNPEVIVIGGGVSGTGSQLFEPVRRMVAEHAYQLPARRVSIVPAELGD
EAGVIGAALYAREELS
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatgcggcaccgatactggtagccgacctgggcggcaccaaggttctggccggg
gcggtgggcgaaggcaatcgcctggaatatcgcgtccggcgcgggtcggccggtgccggc
agtcaggacgaaatcctgaccaacctttacggtgcgctgacagaggtggcggcggccatg
ccggagccgccgcaggctgtagctgttgcctcggccggggccatcgacctggccgccgga
gtcgtcacccattccccgaacatgatggcggttaacggtttgccgctccgcaccatgatt
tcagaaaaatatggcttgccgacggtactgcttaacgacgcctccgccgcggcgctggcc
gagcaccggctgggtgccggccgggggtgccgcgacatgattttcctgaccgtatccacc
ggcatcggcgggggcatcatcatcgacgggcgcctctatcagggaatcgacggtacggcc
ggtgaattcgggcataccgtcatcgaccggcacggagagccggacacctgtggcgcccgc
ggttgtctggagcagtatgcctccgggacggccattgcccgccgggcgaagcaactgctg
gacgccggacgacgttcggaactggaagccgggcgcgaccggttgagcgccgccgatgtg
gctgacgcggcggcccggggcgatgcgctggctaccgaagtcttcgatgaagctctgcag
gcgctggggttgggactggtcagtatagtcaatgtcttcaatcccgaagtcattgtcatc
ggcggcggtgtcagcggaaccggatcacaacttttcgagccggtacgccggatggtggcc
gaacacgcttaccaactgccggcccggcgagtcagcatagtgcccgccgaactgggcgat
gaagccggggtcatcggcgcggcgctgtacgccagggaggaactgagttaa

DBGET integrated database retrieval system