KEGG   Dehalogenimonas lykanthroporepellens: Dehly_1365Help
Entry
Dehly_1365        CDS       T01264                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
dly  Dehalogenimonas lykanthroporepellens
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:dly01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dly00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:dly00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:dly00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:dly00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:dly00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1342133..1343083
Genome map
AA seq 316 aa AA seqDB search
MKNAAPILVADLGGTKVLAGAVGEGNRLEYRVRRGSAGAGSQDEILTNLYGALTEVAAAM
PEPPQAVAVASAGAIDLAAGVVTHSPNMMAVNGLPLRTMISEKYGLPTVLLNDASAAALA
EHRLGAGRGCRDMIFLTVSTGIGGGIIIDGRLYQGIDGTAGEFGHTVIDRHGEPDTCGAR
GCLEQYASGTAIARRAKQLLDAGRRSELEAGRDRLSAADVADAAARGDALATEVFDEALQ
ALGLGLVSIVNVFNPEVIVIGGGVSGTGSQLFEPVRRMVAEHAYQLPARRVSIVPAELGD
EAGVIGAALYAREELS
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatgcggcaccgatactggtagccgacctgggcggcaccaaggttctggccggg
gcggtgggcgaaggcaatcgcctggaatatcgcgtccggcgcgggtcggccggtgccggc
agtcaggacgaaatcctgaccaacctttacggtgcgctgacagaggtggcggcggccatg
ccggagccgccgcaggctgtagctgttgcctcggccggggccatcgacctggccgccgga
gtcgtcacccattccccgaacatgatggcggttaacggtttgccgctccgcaccatgatt
tcagaaaaatatggcttgccgacggtactgcttaacgacgcctccgccgcggcgctggcc
gagcaccggctgggtgccggccgggggtgccgcgacatgattttcctgaccgtatccacc
ggcatcggcgggggcatcatcatcgacgggcgcctctatcagggaatcgacggtacggcc
ggtgaattcgggcataccgtcatcgaccggcacggagagccggacacctgtggcgcccgc
ggttgtctggagcagtatgcctccgggacggccattgcccgccgggcgaagcaactgctg
gacgccggacgacgttcggaactggaagccgggcgcgaccggttgagcgccgccgatgtg
gctgacgcggcggcccggggcgatgcgctggctaccgaagtcttcgatgaagctctgcag
gcgctggggttgggactggtcagtatagtcaatgtcttcaatcccgaagtcattgtcatc
ggcggcggtgtcagcggaaccggatcacaacttttcgagccggtacgccggatggtggcc
gaacacgcttaccaactgccggcccggcgagtcagcatagtgcccgccgaactgggcgat
gaagccggggtcatcggcgcggcgctgtacgccagggaggaactgagttaa

DBGET integrated database retrieval system