KEGG   Dehalogenimonas lykanthroporepellens: Dehly_1366Help
Entry
Dehly_1366        CDS       T01264                                 

Definition
nucleotidyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
dly  Dehalogenimonas lykanthroporepellens
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dly00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dehly_1366
   00052 Galactose metabolism
    Dehly_1366
   00500 Starch and sucrose metabolism
    Dehly_1366
   00520 Amino sugar and nucleotide sugar metabolism
    Dehly_1366
Enzymes [BR:dly01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Dehly_1366
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1343083..1343907
Genome map
AA seq 274 aa AA seqDB search
MSIFKKAVIAAGGAGTRLLPITKSVPKEMLPLGVKPVVQYSVEEITAAGIKDITFVIAHG
KESIVDYFSPDPGLETFLVARGDAASLRKVRALSRMAHFNRVYQSAPLGLGHAVKMARES
VGDEPFALVLPDDVIDAPEPALKQMQEVYKKHPGNILLVAACQPEDTASYGIVDAETISP
GVYRVRDIVEKPRPGEAPSNLAVIGRYLLLPEVFDAVEQLKPGKGGEFQLTDAIRALLDA
QPVYACELDGRHYDMGTPEGRQAAVEAWALRPAH
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgagtattttcaagaaggcggtcatcgccgccggcggcgccggcacgcgtctgctaccg
ataaccaagagcgtgcccaaggagatgttaccgctgggggtcaaaccggttgttcagtac
tcggtggaggaaatcaccgccgccggtatcaaggatatcactttcgtcatcgcccacggc
aaggaatccatcgtggattacttcagtcccgacccggggctggagacgtttctggtggcc
cgcggcgacgccgccagtctgcgcaaggtgcgggcgttatcgcgaatggcccacttcaac
cgggtgtaccagtcagcgccgctgggtctgggccacgccgtcaagatggcccgggagtcg
gtcggcgatgagccgttcgccctggtactgcccgatgacgtcattgacgcgccggaaccg
gcgctcaagcagatgcaggaagtatacaagaagcaccccggcaacattctgctggtggcc
gcctgccagccggaagacacggccagttacggcatcgtcgatgccgagacgatatcgccg
ggggtgtaccgggtcagggacatcgtcgaaaaaccgcgcccgggcgaagccccttccaat
ctggcggtcatcggccgttacctgctgttgcctgaagtgtttgatgccgtggaacaactg
aaacccggcaagggcggggagttccagctgaccgacgccatccgcgccctgctggacgcc
cagccggtctatgcctgcgaactggacggccggcattacgatatgggtacgcccgaaggc
cgccaggcggcggtcgaagcctgggcgcttcgtccggctcattga

DBGET integrated database retrieval system