KEGG   Dehalogenimonas lykanthroporepellens: Dehly_1513Help
Entry
Dehly_1513        CDS       T01264                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
dly  Dehalogenimonas lykanthroporepellens
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:dly00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1483049..1483906
Genome map
AA seq 285 aa AA seqDB search
MIKIKAPAKINLTLEVLGKRPDGYHDIKSVVQEISLADELEFSPAAGMSYTSDSPEWAGD
KSLVSRAAALLKTRYGVEEGANVRVTKRIPLRSGLGGDSSCAAAALKGFNRLWRLGLGVG
QLMELAAELGSDVPFFLMGGTALIEGRGEMVTLLGPFPACWAVIVVPDVNVDDDKTGRLY
RSLSPGDFTDGRRTEELVAALVENRPVEPHMLGNAFERVAAVVWPDIEEYRWQMMKAGAD
RVYLSGAGPALFSLFNKRTKAEKIYAELKTGGNEVYFIGLGNANK
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaatcaaggctccggccaagatcaacctgacgctcgaggttctcggcaaaagg
ccggacggatatcatgatatcaagagtgtggtacaggaaatcagcctggccgatgaattg
gagttcagtccggcggctggcatgtcctacacctccgattcgccggaatgggcgggtgac
aaaagtctggtttcccgagccgccgctttactgaaaacccgttacggggtggaggaaggc
gccaatgtccgggtgaccaagcggataccgttgaggtcaggcttgggcggggactcttcc
tgcgccgccgccgcgctcaagggattcaaccggctgtggcggttggggctgggagtgggt
cagctgatggaactggccgccgaactgggttccgacgttcctttcttcctgatgggcggc
accgctttgatagaaggccggggagaaatggtgacgctgctggggccgttcccggcctgc
tgggcggtcatcgtcgtccccgatgtcaatgttgatgatgacaagactgggcggctctat
cgaagcctgtcgcccggtgatttcaccgacggccggcggacggaagaactggttgccgct
ctggtggagaatcggccggtggaaccccatatgctgggcaacgctttcgagcgggtagcc
gcggtggtctggccggacattgaagaataccgctggcagatgatgaaagctggggctgac
cgggtctatctgtctggtgccgggccggcgttgttcagtttgtttaataaaagaacaaag
gctgaaaagatatatgcagagttgaagacgggagggaacgaagtctactttattggtttg
gggaatgcaaataaatga

DBGET integrated database retrieval system