KEGG   Dehalogenimonas lykanthroporepellens: Dehly_1610Help
Entry
Dehly_1610        CDS       T01264                                 

Definition
type III site-specific deoxyribonuclease (EC:3.1.21.5)
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
dly  Dehalogenimonas lykanthroporepellens
Brite
Enzymes [BR:dly01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     Dehly_1610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1572319..1575297)
Genome map
AA seq 992 aa AA seqDB search
MKLQFDANQQFQLDAVAAITDLFDGQPKGAPEYAVINLGDMAGLFSGQEQTELGIGNRLL
LAEDRLRENTRKVQIQNDIEAPEHEAPLECTELFDVPANTVRRCPHFSVEMETGTGKTYV
YLRTIFELSKKYGFQKFIIVVPSVAIREGVLKNIEITKDHFRALFNNIPFEHFVYDGKKV
NQLRQFAISNTLQIMIINIDAFRKNFSGTEAEQKSNVIYKESDRLSGRQPIEFVQAARPI
VIIDEPQSVDATEKSQEAIRSLNPLCTLRYSATHRSPYNLVYRLDPVKAFELKLVKQIVV
ASAVAEGSANDAFVRVENIEYKKGLKARLKIHVQTKDGPKEKSVTVTSGADLFTLSDERA
CYQHGFSVAEIWGEPGNEYIRFNNGKVLRLGEEMGGLRDDVWRTQIKHTIKKHLDKEVQL
RGRGIKVLSLFFIDRVANYRDYDQSGQPVAGKFARAFEEEFKALAELEHYKDLDSIKYPI
AQLHNGYFAQDRKGILKDTRGDTQADDQVYNLIMKDKERLLSGEEPLRFIFSHSALREGW
DNPNVFQICTLNETQSGIKKRQEIGRGLRLPVDQNGLRVFDDSINKLYIMANESYEDFAR
KLQTEYEEECGVTFGKVPITALAKLCRVIDGQEQPIGRTEAETIKAALMEQKIIDSEGRI
QKGFDPKRPDFKLELADAHQELAPAVIDLLASYQIELHIRKDRDERVNHLKKAVLLGPEF
QELWTRINPKTTYRVEFETAELVNRAVAAIKRMESIEKPKIQVHTGQVSVTRGGVDAAII
ATAEEQVSFRSQPVPDLLAYLQNQTELTRLTLVNILKSSGRLDEFFNNPQRFMDTVAAIL
KNELHRLLVDGIKYERITGKGAEAEWEQMLFKNEEMVNYLTALQVNHSVYEYVEYDSEVE
REFASQLDRREDIKLFVKLPRWFVVDTPVGTYNPDWAILKHDLQTLYLVRETKGTRDFLK
LRNSEADKVRCGAKHFESIGIPFSVVISAKEV
NT seq 2979 nt NT seq  +upstreamnt  +downstreamnt
atgaaactccaatttgacgccaaccagcagttccaactggatgccgtagcggcaataacc
gatttgttcgacgggcaaccgaagggcgccccggagtacgccgtcatcaacctgggggat
atggccggattgttcagcgggcaggagcagacggagctgggaatcggcaaccggttgctg
ttggcggaggaccggcttcgggagaacaccagaaaagtccagatacagaacgacatcgaa
gccccggaacacgaagcgccgctggagtgtacggaactcttcgacgtcccggccaatacg
gtccggcgctgtccccacttttcggtggaaatggaaacgggcacgggaaaaacgtatgta
tatctccggactattttcgaactttcaaaaaaatacggatttcagaagttcattatcgta
gtgccttccgtcgccattcgcgaaggagtgctgaagaacatcgagattaccaaggatcat
ttccgcgccctcttcaacaatatcccgttcgaacactttgtctatgacggcaaaaaggtc
aaccaactgcgtcagttcgccatcagcaacaccctgcagatcatgattatcaacatcgac
gccttccggaagaatttctccggcaccgaagcagagcagaaaagtaatgtcatttacaag
gaaagcgacagactgtccggacgccagccgattgagttcgtccaggccgcccgcccgatt
gtgattattgatgaaccccagagcgtggacgcgaccgaaaagtcccaggaagccatccgg
tccctgaatccgctttgcaccctgcgctattccgccacccatcgtagtccttacaacctc
gtttatcgtctagaccctgtcaaagccttcgagttgaaactggtgaaacagatcgtggtg
gccagcgcagtggcggaaggcagtgccaatgacgcctttgtccgggtggaaaacatcgag
tataaaaaaggcctcaaagccaggctgaaaatccatgttcaaaccaaggacgggccgaag
gagaagtccgttaccgtgacaagcggcgccgacctgttcaccctgtctgatgaacgggcc
tgttatcagcatggtttctccgtcgctgaaatctggggcgaaccaggtaacgaatatatc
agattcaacaacggtaaagttctgcgcctgggtgaagagatgggaggactgcgtgacgat
gtctggcgaacacagataaaacacaccataaaaaagcacctggacaaggaagtacaactg
cgcggccgcggcatcaaggtgctgagtcttttcttcattgaccgcgtggccaactatcgg
gattatgaccaatccgggcaaccggtagcggggaaattcgccagggcattcgaggaagaa
ttcaaggcgctggccgaacttgaacactataaggatttagacagcatcaaatacccaatc
gcccaactgcataacggttacttcgcccaggacaggaaagggatcctgaaggatacccgg
ggcgacacccaggcggatgaccaggtttataacctcatcatgaaagacaaggagagacta
ctgtccggcgaagagccgctcaggtttattttcagtcattcggcattgagggagggttgg
gacaaccccaatgtcttccagatttgcaccctcaatgaaactcaaagcggtatcaaaaag
cgccaggaaataggccgggggctgagactgccggtggatcagaacggcctgagagtattc
gatgattccatcaacaaactttatatcatggccaacgaaagctatgaagatttcgcccgt
aagctccagacagaatacgaagaagaatgcggcgttaccttcggcaaggttccgataacc
gccttggcaaagctgtgccgggtgattgacggacaggaacagccgataggacgcaccgag
gcggagactatcaaggccgcgctgatggagcaaaaaataatcgattccgaaggacgcatc
caaaagggattcgatccgaagcgacctgatttcaaattagagctggccgatgcgcatcag
gaactggcgccggcagtgatcgatttactcgcttcctaccagatcgaactccatatccgc
aaggacagagacgagcgggtcaaccacctgaagaaggcagtgcttctggggccagagttc
caggaattatggacgcgcataaatcccaaaacgacttaccgggttgagttcgaaaccgcg
gaattggtcaatcgggcggtagcggctatcaaacggatggaaagtatagagaagccgaag
attcaggttcataccgggcaagtgagcgtcaccagaggcggagtcgatgccgctatcatc
gctacggccgaagaacaggtttctttcaggtctcaaccagtcccggacctgctggcctat
ctgcaaaatcagacggagctgacccgtttgacactggtcaacatcctgaaatcatccggg
cgactagatgagtttttcaataatccccagcgattcatggatacagtggcggctatcctg
aaaaatgaacttcaccggttgctggtggacggcatcaaatatgagcggataacaggcaaa
ggggcggaagcagaatgggagcagatgctattcaagaatgaggaaatggtaaattacctc
accgccttgcaggtaaatcactcggtttacgaatatgtggagtatgattctgaagtagag
cgcgagtttgccagccagctggaccgtcgcgaagatatcaaactattcgtcaaactgcca
agatggttcgtggtggacacaccggtcggcacttacaatccggattgggcaatcctgaaa
catgaccttcaaactttgtacctggtacgcgaaaccaaaggcaccagggatttcctgaaa
ttgcgcaacagcgaagccgacaaggtgcgctgtggggcgaaacatttcgaaagcatcggc
atccccttttctgtggttatatctgccaaagaagtatga

DBGET integrated database retrieval system