KEGG   Dehalogenimonas lykanthroporepellens: Dehly_1690Help
Entry
Dehly_1690        CDS       T01264                                 

Definition
UvrD/REP helicase
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
dly  Dehalogenimonas lykanthroporepellens
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:dly00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Dehly_1690
Enzymes [BR:dly01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Dehly_1690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1660056..1662284)
Genome map
AA seq 742 aa AA seqDB search
MPKRNESNPARLRGRIERVYYAGPKFSAGRLLTPTGEEVQFAGNLFARENQPVVLLGSWS
THPKYGRQFKVDGMEHDLELDPEGLIHYLANHPEIKGIGPAKARLIVESFGDAFEETLLN
DPERIALKARLPLDAARRLRDEWLKNRSVNAVMAWLSAFGLTHHQVNTLVERLGGNCLDI
LKEDPYILIREIRGFGFKKVDKIARKLGTPKDHTPRIRAGLNFCVREALDNGHCWIEYED
LVDQANLLLVMDALDSRVRIESALDALIEEQALSCDSHGGRFVVALPEIVRMERELASLF
SQAETPNPHFQSVKKLDALIRRCASTLNEKQLEAVRSALQHSISLISGGAGSGKSYTISV
INTICEESDLEVVLAAPTGKAAKRLEEVSGRSGTTIHRLLGYDGKGFSRSKENPIDADVL
VVDEFSMVDVPLAWHLFEAVDLSRTTVLLVGDHNQLPPVGPGNILRDLIQTRAIPTVILD
KVVRQAGVLKENCTAVLKGEVRKTSEASVGGCRDWYLVDQFTDPMAARSFLLELFQERLD
ALGFDIIKDVQVLTPTHKGPLGTKELNEELQRLIQRKLWNTEVPPVAMGRRAPFLKHDKV
IQTRNNYDLNVMNGAIGYVVDVLANGTLVIDFDGMPVELEKGSPDLQDLQLAYALTIHKT
QGSEFPCAVVVVHKAHSFMHHRNLLYTGVTRARRTAIVLGDHWGIQNCAKRCQVDDRRTF
LPLFLDAAQHAEADFARVAEAE
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaaagaaatgagagtaacccggcgcgactccggggaagaatagagcgcgtttac
tatgctggacccaagttctccgcaggccgactgctcaccccgaccggtgaggaagtccag
ttcgcgggcaatttgttcgcccgggaaaatcagcctgtggtcctgctcggttcgtggtcc
acccatcccaaatacggccgtcagttcaaggtcgacgggatggagcacgacctcgaactc
gatccggaggggctgatccactatctggccaaccatccggagatcaagggcattggtccg
gccaaggccagattgatcgtcgagagtttcggcgacgcctttgaagaaacccttctgaat
gaccccgagcgcatcgcgctcaaagcccggctgcccttggatgctgcccggcggctgcgt
gacgaatggttgaagaaccgcagcgtcaacgccgtcatggcctggttgtcggcattcggt
ctgacccatcatcaggtcaacaccctggtcgaaagactcggcggcaactgcctcgatatt
ctgaaggaagacccgtatatcctcattcgggagatccggggattcggcttcaagaaggtc
gacaagatcgcccgcaagctgggcacccccaaggaccacacccctcgtatccgcgctggg
ttgaatttctgcgtccgtgaagccctggacaatggtcactgctggatcgaatacgaggat
ctggtggatcaggccaacctgctgctggtcatggatgccttggacagccgggtccgtatc
gagagcgccctcgacgcgctcatcgaagaacaggcgctttcctgcgattcccacggcgga
cgtttcgtggtcgctctgccggagatcgtccgcatggagcgggagctggcctcgttgttc
agccaggccgaaacaccgaatcctcatttccagtccgtcaagaagctcgatgccctgatt
cggcgctgcgcatcaacgctgaacgagaagcagctcgaagcggtgcgctcggccctccag
cacagcatcagcctgatttcgggtggagccggttcgggcaagagctacaccatttcggtc
atcaacaccatctgcgaggagagcgatctggaggtcgtgctcgccgcgccgaccggcaag
gcggccaagcgcctggaggaagtcagcggtcgcagcggcaccaccatccaccgtctgctc
ggctatgacggcaagggtttctcgcgtagcaaggagaaccccatcgatgccgatgtcctg
gtggtcgacgagttttcgatggtcgatgtgcccctggcatggcacttgttcgaggcggtc
gatctgtcgcggaccacggtgctgctggtcggggaccacaaccagcttccgccggtggga
ccagggaacatcctgcgcgatctgatccagacacgcgccatccccacggtcatcctcgac
aaggtcgtgcgtcaggctggtgtcctcaaggagaactgcaccgccgttctcaagggcgag
gtgcgcaagaccagcgaggcgtcggtgggcggatgccgggattggtatctggtggatcag
ttcaccgacccgatggcggcacgctcgttcctgctggagttgtttcaggagcggctcgat
gccctgggtttcgacatcatcaaggacgtgcaggtgctgacgccgacccacaaggggccg
ctcggcaccaaggaattgaacgaggaactgcagcggctcatccagcgcaagctctggaac
accgaagtgccgccggtcgccatgggacgccgcgcaccgtttctcaagcacgacaaggtc
atccagacccggaacaattacgacctgaacgtaatgaacggtgccatcggctatgtggtc
gatgttctcgcgaacggcacactggtcatcgacttcgacggcatgccggtggaactggag
aaagggtcgcccgacctgcaagatctgcagctcgcctatgcgctcaccatccacaaaacc
cagggttccgagttcccctgtgccgtggtggtggttcacaaggcgcattccttcatgcac
caccgcaatctgctctacaccggggtgacccgcgcccggcgcaccgccattgtcctgggt
gaccattggggcattcagaactgcgccaagcggtgccaggtggatgaccgccggaccttt
ctgcccctgttcctggacgccgcccaacacgcggaagccgatttcgcccgtgtcgcggag
gccgaatga

DBGET integrated database retrieval system