KEGG   Desulfovibrio magneticus: DMR_02370Help
Entry
DMR_02370         CDS       T00917                                 

Definition
tungsten-containing aldehyde ferredoxin oxidoreductase
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
dma  Desulfovibrio magneticus
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:dma01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:dma00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(248841..250568)
Genome map
AA seq 575 aa AA seqDB search
MPKFIRIDMGAKAVKIEECPEKYAGLAGRGLTSIFVADEVKPTCHPLGKNNKLIFAPGYL
TGTSAANSGRLSCGAKSPLTGGIKESNTGGTFAQRMSKMDIKALVFEGLPEGDGFYVVKV
TMDGATIEEAPAEIIGMGNYEAIKVLQAKYGPKVGVAIIGPAGEMRLTAANISFADPQSN
IRSAGRGGLGAVMGAKKIKAVVIDDTGAPGVTIANPEAFKDASKRFTNALTTHPVTGQAL
PKYGTNILINILNEAGGLPTKNFRTGRNEWANNVGGETMAAVIESRKGKTTHGCHAGCII
RCSQHYNDKDEKYLTSGFEYETIWALGANACVDDLDAIAYADREFDDVGVDSIETAVTVG
VAMEAGIIPWGDAKAMLNLILEIRKGTPLGRILGSGAGALGQMYGLSRVPTVKNQAIPAY
DPRAVKGVGLTYATTPMGADHTAGYAVATNILKVGGFVDPLGKEGQVELSRNLQIATAAV
DSTGMCLFIAFAILDIADGFNALVEMINARYNLSLTGDDVVALGKTILKAERGFNERAGF
TKAHDRLPEFFEEPCAPHNVTWDFTDEEIDEVFNF
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgccaaagttcattcgtatcgacatgggcgcgaaagcggtgaagatcgaggaatgcccc
gaaaagtacgccggcctggccggccgcgggctgacctccattttcgtggctgatgaagtg
aagccgacctgccatccccttggcaagaacaacaagctgatcttcgcccccgggtatttg
accggcaccagcgccgccaactccggccgcctgtcctgcggggccaaaagccctctcacc
ggcggcatcaaggaaagcaacaccggcggcaccttcgcccagcgcatgtccaagatggac
atcaaggccctggttttcgaaggcctgcccgagggcgacggcttctacgtcgtcaaggtc
accatggacggcgcgaccattgaggaagccccggccgaaatcatcggcatgggcaactac
gaagccatcaaggtcctgcaagccaagtacggccccaaggtcggcgtggccatcatcgga
ccggccggcgaaatgcgcctgaccgccgccaacatttcctttgccgatccccagagcaac
atccgcagcgccggccgcggcggcctgggcgcggtcatgggcgcgaaaaagatcaaagcc
gtggtcatcgacgacaccggcgcgcccggcgtgaccatcgccaatcccgaagccttcaag
gacgcgtccaagcgcttcaccaacgccctgaccacccacccggtcaccggccaggccctg
cccaagtacggcaccaacatcctcatcaacatccttaacgaggccggcggcctgcccacc
aagaacttccgcaccggccgcaacgagtgggccaacaacgtcggcggcgaaaccatggcc
gccgtcatcgagtcccgcaagggcaagaccacccacggctgccatgccggctgcatcatc
cgctgctcccagcactacaacgacaaggacgagaagtacctgaccagcggtttcgagtat
gagaccatctgggctcttggcgccaacgcctgcgtggacgacctcgacgccatcgcttac
gccgaccgcgagttcgacgacgtgggcgtggactccatcgagaccgccgtcaccgtgggc
gtggccatggaagccggcatcatcccctggggcgacgccaaggccatgctgaacctcatc
ctggaaatccgcaaaggcaccccccttggccgcatcctgggcagcggcgccggcgccctt
ggccagatgtatggcttaagccgcgtgcccacggtgaaaaaccaggccatcccggcctac
gacccgcgcgccgtcaagggcgtcggcctgacctacgccaccacgcccatgggcgcggac
cacaccgccggctacgccgtggccaccaatatcctcaaggtcggcggcttcgtcgatccg
ctgggcaaggaaggccaggtcgagctgtcgcgcaatctgcagatcgccaccgccgccgtg
gacagcaccggcatgtgtctgttcatcgcctttgccatcctggacatcgccgacggcttc
aacgccctggtggagatgatcaacgcccgctacaacctgtcgcttaccggcgacgacgtg
gtggccctgggcaagaccatcctcaaggccgagcgcggcttcaacgagcgcgccggcttc
accaaggcccacgaccggctgccggagttctttgaagagccctgcgccccgcacaacgtg
acctgggacttcaccgacgaagagatcgacgaggtcttcaacttctag

DBGET integrated database retrieval system