KEGG   Desulfovibrio magneticus: DMR_03860Help
Entry
DMR_03860         CDS       T00917                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
dma  Desulfovibrio magneticus
Pathway
dma00900  Terpenoid backbone biosynthesis
dma01100  Metabolic pathways
dma01110  Biosynthesis of secondary metabolites
dma01130  Biosynthesis of antibiotics
Module
dma_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:dma00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DMR_03860 (dxr)
Enzymes [BR:dma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     DMR_03860 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C
Motif
Other DBs
NCBI-ProteinID: BAH73877
NITE: DMR_03860
UniProt: C4XHA9
Position
complement(447602..448864)
Genome map
AA seq 420 aa AA seqDB search
MTPISAANAAGPCPCPGQGYISSLSARDPGRPRRLALLGATGSIGVSTLKVAAEHPGEYD
VVALAGATNVKLLAKQAAAFRPAVLAVIDDARAAALAELLPAGYRPDILTGPAGYAALAS
APEVDLVVSAIVGAAGLGPTLAAVAAGKIVALANKESLVLAGDLIRAAAAASGAVILPVD
SEHNALFQALGGVGLPDLPLVEKLVLTASGGPFRCADRACLETVTPAMALAHPNWSMGPK
ISVDSATLMNKGLEVIEACRLYGLPVSQVDVVVHPQSIVHSLAQLHDGSLLAHLGPPDMR
VAIAYCLGYPRRLSLAVPRVDLVKLAALTFEAPRDDDFPCLGLARQALCGGASHTVVLNA
ANEVAVDLFLTERLAFLDIPAAIAAALDAHAGQPLPDVATVADLDARVRRETADWAARRR
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgaccccgatttccgccgccaacgcggctggtccctgtccctgccccggccaaggctat
atctcctccctgtccgcccgcgaccccgggcggccgaggcgcttggccctgctcggggcc
accggctccatcggcgtcagcacgctgaaagtcgcggctgagcatcccggcgaatacgac
gtcgtggccctggccggcgcgaccaacgtgaagcttttggctaagcaggccgccgccttc
cggccggccgtgctggccgtcatcgacgacgcccgggccgccgccctggccgagctgctg
ccggccggctaccgcccggacatcctcaccggcccggccggctacgccgccctggccagc
gccccggaggtcgatctcgtggtctcggccatcgtgggcgcggccggccttggaccgacg
ctggccgccgtggccgccggcaagatcgtggccctggccaacaaggaatccctggtcctg
gccggcgacctcatccgggccgccgccgccgcctcgggcgcggtgatcctgcccgtggac
tccgaacacaacgccctgttccaggccctgggcggcgtgggcctgcccgatctgcccctg
gtcgaaaagctggtcttgaccgcctcgggcggccctttccgctgcgccgaccgggcctgc
ctggaaaccgtcaccccggccatggccctggcccaccccaactggtccatgggccccaaa
atcagcgtggattccgccaccctcatgaacaagggcctggaggtcatcgaggcctgccgg
ctgtatggcctgcccgtgtcccaggtggacgtggtggtccatccccaaagcatcgtccac
tccctggcccagctccacgacggctcgcttctggcccacctcggcccgcccgacatgcgc
gtggccatcgcctactgcctgggctatccgcgccggctgtccctggccgtgccccgggtc
gatctggtcaaactggcggcgctgaccttcgaagccccgcgcgacgacgattttccctgc
ctgggcctggcccgacaggcgctttgcggcggcgccagccacaccgtggtcctcaacgcc
gccaacgaagtggccgtggaccttttcctgaccgaacgcctggctttcctggacattccg
gcggccatcgcggctgcccttgacgcccacgccgggcagcccctgcccgatgtcgcgacc
gtcgccgacctcgacgcccgggtgcgccgggaaacggccgactgggccgcgcggcggcga
taa

DBGET integrated database retrieval system