KEGG   Desulfovibrio magneticus: DMR_04460Help
Entry
DMR_04460         CDS       T00917                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
dma  Desulfovibrio magneticus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:dma00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
511933..512916
Genome map
AA seq 327 aa AA seqDB search
MNIGDFHRGRRLRRTEGLRDLVRETELRPADLIQGYFVVDSPDADFEKPIKSMPGQSQFS
VERLVARVGQAMDLGLRAAIVFGLPAKKDPAGTGAYADDGIVQRAVTRLKETYPSLTVVT
DVCLCEYTSHGHCGLLDAHGEVRNDPTLELLARTAVSHVRAGADIVAPSDMMDGRVAAIR
EALDDAGFFHIPIMSYAVKYASAFYGPFRDAADSAPAFGDRRGYQMDPANFREGLREAAA
DLAEGADILMVKPAMPYLDVLRALRDNFDTPIAAYQVSGEYAMLKAAIANGWLDPKRSVL
EALLGIKRAGADMIITYFAEEVLPWIK
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
gtgaatatcggtgatttccaccgtggccgtcgtctgcggcgcacggaagggctgcgcgac
ctggtccgcgagaccgagttgcgcccggccgacctgatccagggctatttcgtggtcgat
tccccggacgccgactttgaaaagcccatcaaatccatgcccggccagagccagttctcg
gtggagcggctggtggcccgggtgggccaggccatggacctggggcttcgggcggccatc
gtcttcggcctgccggccaagaaagacccggccggcaccggagcctacgccgacgacggc
atcgtgcagcgggccgtcacgcgcctgaaggaaacctacccctcgctcaccgtggtcacc
gacgtgtgcctgtgcgaatacaccagccatggccactgcggcctgctcgacgcccacggc
gaggtgcgaaacgacccgaccctggaactgctggccaggacggccgtgagccatgtccgg
gccggggccgacatcgtggccccctcggacatgatggacggccgggtggcggccatccgg
gaagcactcgatgatgccggctttttccatatccccatcatgagctacgccgtcaaatac
gcctcggccttctatggtcccttccgcgacgccgccgacagcgccccggccttcggcgac
cgccggggctaccagatggacccggccaacttccgcgaaggcctgcgcgaggccgcggcc
gatctggccgagggcgcggacatcctcatggtcaagccggccatgccctatctcgacgtc
ttgcgggcgctgcgggacaatttcgacacgcccatcgccgcctatcaggtcagcggcgag
tatgccatgctcaaagccgccatcgccaacggctggctcgaccccaagcgttcggtgctt
gaggcgctcctgggcatcaaacgggccggcgcggacatgatcattacctacttcgccgag
gaagtgctgccctggatcaaatag

DBGET integrated database retrieval system