KEGG   Desulfovibrio magneticus: DMR_04460Help
Entry
DMR_04460         CDS       T00917                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
dma  Desulfovibrio magneticus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dma00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    DMR_04460 (hemB)
Enzymes [BR:dma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     DMR_04460 (hemB)
Exosome [BR:dma04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DMR_04460 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
511933..512916
Genome map
AA seq 327 aa AA seqDB search
MNIGDFHRGRRLRRTEGLRDLVRETELRPADLIQGYFVVDSPDADFEKPIKSMPGQSQFS
VERLVARVGQAMDLGLRAAIVFGLPAKKDPAGTGAYADDGIVQRAVTRLKETYPSLTVVT
DVCLCEYTSHGHCGLLDAHGEVRNDPTLELLARTAVSHVRAGADIVAPSDMMDGRVAAIR
EALDDAGFFHIPIMSYAVKYASAFYGPFRDAADSAPAFGDRRGYQMDPANFREGLREAAA
DLAEGADILMVKPAMPYLDVLRALRDNFDTPIAAYQVSGEYAMLKAAIANGWLDPKRSVL
EALLGIKRAGADMIITYFAEEVLPWIK
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
gtgaatatcggtgatttccaccgtggccgtcgtctgcggcgcacggaagggctgcgcgac
ctggtccgcgagaccgagttgcgcccggccgacctgatccagggctatttcgtggtcgat
tccccggacgccgactttgaaaagcccatcaaatccatgcccggccagagccagttctcg
gtggagcggctggtggcccgggtgggccaggccatggacctggggcttcgggcggccatc
gtcttcggcctgccggccaagaaagacccggccggcaccggagcctacgccgacgacggc
atcgtgcagcgggccgtcacgcgcctgaaggaaacctacccctcgctcaccgtggtcacc
gacgtgtgcctgtgcgaatacaccagccatggccactgcggcctgctcgacgcccacggc
gaggtgcgaaacgacccgaccctggaactgctggccaggacggccgtgagccatgtccgg
gccggggccgacatcgtggccccctcggacatgatggacggccgggtggcggccatccgg
gaagcactcgatgatgccggctttttccatatccccatcatgagctacgccgtcaaatac
gcctcggccttctatggtcccttccgcgacgccgccgacagcgccccggccttcggcgac
cgccggggctaccagatggacccggccaacttccgcgaaggcctgcgcgaggccgcggcc
gatctggccgagggcgcggacatcctcatggtcaagccggccatgccctatctcgacgtc
ttgcgggcgctgcgggacaatttcgacacgcccatcgccgcctatcaggtcagcggcgag
tatgccatgctcaaagccgccatcgccaacggctggctcgaccccaagcgttcggtgctt
gaggcgctcctgggcatcaaacgggccggcgcggacatgatcattacctacttcgccgag
gaagtgctgccctggatcaaatag

DBGET integrated database retrieval system