KEGG   Desulfovibrio magneticus: DMR_05250Help
Entry
DMR_05250         CDS       T00917                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
dma  Desulfovibrio magneticus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dma00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    DMR_05250 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DMR_05250 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DMR_05250 (trpA)
Enzymes [BR:dma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     DMR_05250 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
complement(587555..588325)
Genome map
AA seq 256 aa AA seqDB search
MSQSILTTRIMEALAAGRKALIPFLPGGFPDKERFFDELAALDAGGADIIEIGVPFSDPV
ADGPVVEQASLDCLLNGTCLSWLFYELGKRKGQYRAGLVLMGYYNPFLQYGLEQLAADAA
DAGVSGFIVPDVPLEESGPLREALDKHGLDLIPLVGLNTSEERLAAYAQNARGYVYFVSV
LGTTGMRESLPTEVKERLTAVRRIFNVPVALGFGIKSPEQLYAFGDLVDGVVFGSALIAH
IKAGGTAAEFMARWRG
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgagccagtccatcctgaccacccgcatcatggaagccctggccgccgggcgcaaggcg
ctcatccccttcctgcccggcggtttcccggacaaggagcgctttttcgacgaactggcc
gccctggacgccggcggggccgacatcatcgagatcggcgtgcccttctccgaccccgtg
gccgatgggccggtggtggagcaggccagcctggattgcctgctcaacggcacctgtttg
tcgtggcttttttacgagttgggcaagcgcaagggccagtaccgggccgggcttgtgctc
atgggctactacaacccgtttttgcagtacggcctggagcagttggccgccgacgcggcc
gacgccggggtgtcgggctttattgtcccggacgtgccccttgaggagtccggcccgctg
cgcgaggccctggacaagcacggcctggacctcatccccctggtggggctcaacacctcc
gaggagcggctggccgcctacgcccaaaacgcccggggctacgtctacttcgtgtccgtg
ctgggcaccaccggcatgcgggaatcgctgcccaccgaggtcaaggaacgcctgaccgcc
gtgcgccgcattttcaacgtcccggtggcgctcgggttcggcatcaaatcccccgagcag
ctctacgcctttggcgacctcgtggacggcgtggtctttgggtcggcgctcatcgcccac
atcaaggccggcggcacggccgccgagttcatggcccgctggcgcggctga

DBGET integrated database retrieval system