KEGG   Desulfovibrio magneticus: DMR_05280Help
Entry
DMR_05280         CDS       T00917                                 

Gene name
trpC
Definition
indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
dma  Desulfovibrio magneticus
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:dma01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:dma00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(590337..591107)
Genome map
AA seq 256 aa AA seqDB search
MLEKFRAAKAAEVRRLVGLEAAQQLPEPYKGKRPSFSDALIAKAPMAVIAEYKRASPSMG
DINLGLGPHDVAAMYAASGAAAISVLTEETYFKGSLDYLETMSRCGLPLLRKDFLLHPLQ
VVQTAATKASALLLIVRMLTDVELNEMLRLTYDAGLEAVVEVFDERDLERAEAAGAHIIQ
VNNRDLDTLKTDFAVATRLAAYKRPGRLWIAASGIKTRADVEAMQALGFDAVLVGTSIMA
EADPGAALARLAGSAA
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgcttgagaagtttcgggccgccaaggcggccgaagtgcgccgactggtcggccttgag
gcggcccagcagctgcccgagccctacaagggcaaacggccgtcgttttccgacgcgctc
atcgccaaggctcccatggccgtcatcgccgagtacaagcgggcgtcgccttccatgggc
gacatcaacctcggccttggcccccacgacgtggccgccatgtacgccgcctcgggagcc
gccgccatctcggtcttgaccgaggagacctacttcaaggggtccctggactacctcgaa
accatgagccgttgcggtctgccacttctgcgcaaggacttcctgctccatcccttgcag
gtggtgcagacggcggccaccaaggcctcggccttgctgctcatcgtgcggatgctcacc
gatgtggaattaaacgaaatgctgcgcctgacctacgacgcgggcctggaagccgtggtc
gaggtctttgacgagcgcgacctggaacgcgccgaagccgccggcgcgcacatcatccag
gtcaacaaccgcgacctggatacgctcaaaaccgacttcgccgtggccacccggctggcc
gcctacaaacgccccggccggctgtggatcgccgccagcggcatcaagacccgggccgac
gtggaggccatgcaggccctcggcttcgacgccgtgctggtcggcacctccatcatggcc
gaggccgaccccggcgcggccctggcccggctggccgggagcgcggcatga

DBGET integrated database retrieval system