KEGG   Desulfovibrio magneticus: DMR_11700Help
Entry
DMR_11700         CDS       T00917                                 

Definition
lipolytic enzyme G-D-S-L family protein
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
dma  Desulfovibrio magneticus
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:dma00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    DMR_11700
Enzymes [BR:dma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     DMR_11700
   3.1.2  Thioester hydrolases
    3.1.2.-  
     DMR_11700
Lipid biosynthesis proteins [BR:dma01004]
 Fatty acid synthase
  Component type
   DMR_11700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(1290569..1291363)
Genome map
AA seq 264 aa AA seqDB search
MLTPPAWLCNVSRTSDKEIMHASNIPTAGAPRPVPSPAGYQLARKRQTAPVCLALALALA
LAVLGVFMPQTAPAATLAALGDSLTAGWGLPAADAYPAKLARALAARGYDVDILNFGISG
DTTAGGLARLDAVLAAKPAGVILELGANDMLRGLPTAVPRDNLDAILARLKAAGIPVLLC
GIQAMRNYGLGYARDLDAVYAELSKKYDAVLYPSFLDGVTGVPGLTMPDGLHPTAAGVDE
MVRRSLPAVETFLSRLGVRPAGAP
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgttgaccccgccggcctggctttgtaacgtcagccgcacatcggacaaggaaatcatg
cacgcctccaacatccccacagcgggcgcgccgcgccccgtgccgtccccggcaggatac
cagcttgcccggaaaagacaaaccgcgccggtttgcctggccctggccctggccctggct
ctggccgttcttggagttttcatgccgcagaccgccccggccgcaaccctggccgccctg
ggcgacagcctcaccgccggctggggactgcccgccgccgacgcctacccggccaagctc
gcccgcgccctggccgcgcgcggctatgacgtggacatcctcaatttcggcatctccggc
gacaccaccgccggcggtctggcccgcctcgacgcggtgctggccgccaaaccggccggc
gtcatcctggaactcggggccaacgacatgctgcgcggcctgcccacggccgtgccccgg
gacaacctcgacgccatcctggcccggctcaaggcggccggcatcccggtcctgctctgc
ggcatccaggccatgcgcaactacggcctgggctacgcccgcgacctcgacgccgtctac
gccgagctgagcaagaaatacgacgccgtgctctacccgtcctttctcgacggcgtcacc
ggcgttcccggcctgaccatgcccgacggcctgcatcccaccgccgccggagtggacgaa
atggtgcggcgcagcctgcccgccgtggaaacctttctctcgcgcctgggcgtgcgcccg
gccggcgcgccgtaa

DBGET integrated database retrieval system