KEGG   Desulfovibrio magneticus: DMR_11700Help
Entry
DMR_11700         CDS       T00917                                 

Definition
lipolytic enzyme G-D-S-L family protein
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
dma  Desulfovibrio magneticus
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:dma01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(1290569..1291363)
Genome map
AA seq 264 aa AA seqDB search
MLTPPAWLCNVSRTSDKEIMHASNIPTAGAPRPVPSPAGYQLARKRQTAPVCLALALALA
LAVLGVFMPQTAPAATLAALGDSLTAGWGLPAADAYPAKLARALAARGYDVDILNFGISG
DTTAGGLARLDAVLAAKPAGVILELGANDMLRGLPTAVPRDNLDAILARLKAAGIPVLLC
GIQAMRNYGLGYARDLDAVYAELSKKYDAVLYPSFLDGVTGVPGLTMPDGLHPTAAGVDE
MVRRSLPAVETFLSRLGVRPAGAP
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgttgaccccgccggcctggctttgtaacgtcagccgcacatcggacaaggaaatcatg
cacgcctccaacatccccacagcgggcgcgccgcgccccgtgccgtccccggcaggatac
cagcttgcccggaaaagacaaaccgcgccggtttgcctggccctggccctggccctggct
ctggccgttcttggagttttcatgccgcagaccgccccggccgcaaccctggccgccctg
ggcgacagcctcaccgccggctggggactgcccgccgccgacgcctacccggccaagctc
gcccgcgccctggccgcgcgcggctatgacgtggacatcctcaatttcggcatctccggc
gacaccaccgccggcggtctggcccgcctcgacgcggtgctggccgccaaaccggccggc
gtcatcctggaactcggggccaacgacatgctgcgcggcctgcccacggccgtgccccgg
gacaacctcgacgccatcctggcccggctcaaggcggccggcatcccggtcctgctctgc
ggcatccaggccatgcgcaactacggcctgggctacgcccgcgacctcgacgccgtctac
gccgagctgagcaagaaatacgacgccgtgctctacccgtcctttctcgacggcgtcacc
ggcgttcccggcctgaccatgcccgacggcctgcatcccaccgccgccggagtggacgaa
atggtgcggcgcagcctgcccgccgtggaaacctttctctcgcgcctgggcgtgcgcccg
gccggcgcgccgtaa

DBGET integrated database retrieval system