KEGG   Desulfovibrio magneticus: DMR_15600Help
Entry
DMR_15600         CDS       T00917                                 

Definition
NiFe hydrogenase large subunit
Orthology
K00437  
[NiFe] hydrogenase large subunit [EC:1.12.2.1]
Organism
dma  Desulfovibrio magneticus
Brite
Enzymes [BR:dma01000]
 1. Oxidoreductases
  1.12  Acting on hydrogen as donor
   1.12.2  With a cytochrome as acceptor
    1.12.2.1  cytochrome-c3 hydrogenase
     DMR_15600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(1723012..1724706)
Genome map
AA seq 564 aa AA seqDB search
MAETNPTPQSTFTGPLVVDPITRIEGHLRIMVEVENGKVKDAWSSSQLFRGLEIILKGRD
PRDAQHFTQRACGVCTYVHGLASTRCVDDAVKVNIPANARMMRNLVMASQYLHDHLVHFY
HLHALDWVDVTNALKADPVKAAKLAETIAPARPGNSAESLKAVQDKLKAFVETGQLGIFT
NAYFLGGHKAYYLPPEVDLIATAHYLEALHMQVKAASAMAILGGKNPHTQFTVVGGCSNY
NAMSKDALANYLSLTQEVCKFVNDVYIPDLLAVAGFYKDWGGIGGCTNYMAFGEFATDES
TPEKHMESSFFPAGVIMNRDLGKVDKVDLGAIYEDVKYSWYKPGADGLHPYDGVTDPKYT
KLDDKDHYSWMKAPRYKGKAMEVGPLARCFLAYAKGQPEFKKIIDTVLTKLSVPATALHS
TLGRTAARGIETAIVAAKMETWIKEFADSSAKDNTLCAKWEMPGESKGVGLCDAPRGALS
HWIRIKDKKIDNFQLVVPSTWNLGPRGAAGDKSPVEEALIGTPIADPKRPVEILRTVHAF
DPCIACGVHVIEPETNEILKFKVV
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atggctgagacgaatcccacgccgcaatcgaccttcaccggcccccttgtggtcgatccc
atcacccgcatcgaaggtcacttgcggatcatggtcgaagtggaaaacggcaaagtgaaa
gacgcgtggagctcctcgcagctcttccgcggtctggaaatcatcctcaagggccgcgat
ccccgcgacgcccagcacttcacccagcgcgcctgcggcgtgtgcacctacgtgcacggc
ctggcctcgacccgctgcgtcgacgacgccgtcaaggtcaacatcccggccaacgcccgc
atgatgcgcaacctggtcatggcctcccagtatctccatgaccacctggtccacttctat
cacctccacgccctggactgggtggacgtgaccaacgcgctgaaggccgatccggtcaag
gccgccaagctggccgaaaccatcgccccggcccgccccggcaactccgccgagagcctc
aaggccgttcaggacaaactgaaagccttcgtggaaaccggccagctcggcatcttcacc
aacgcctacttcctcggcggccacaaagcctactacctgccgcccgaagtcgatctcatc
gccaccgcccactacctggaagccctgcacatgcaggtcaaggcggccagcgccatggcc
atcctcggcggcaagaacccccacacccagttcaccgtcgtgggcggttgctccaactac
aacgccatgtccaaggacgccctggccaactacctgtcgctgacccaggaagtctgcaag
ttcgtcaatgacgtctacatccccgatctgctggccgtggccggcttctacaaggattgg
ggcggcatcggcggctgcaccaactatatggccttcggcgagttcgccaccgacgaaagc
acccccgaaaagcacatggagtcgtcgttcttcccggccggcgtcatcatgaaccgcgac
ctcggcaaggtggacaaggtcgatctcggcgccatctacgaagacgtcaagtactcctgg
tacaagcccggcgccgacggcctgcatccctacgacggcgtcaccgatcccaagtacacc
aagctcgacgacaaggaccactactcctggatgaaggccccccgctacaagggcaaggcc
atggaagtcggtcccctggcccggtgtttcctggcctacgccaagggacagcccgagttc
aagaagatcatcgacaccgtcctgaccaagctctccgtcccggccacggccctgcactcg
accctgggccgcaccgccgcccgcggcatcgagaccgccatcgtcgccgccaagatggaa
acctggatcaaggaattcgccgacagctccgccaaggacaacaccttgtgcgccaagtgg
gaaatgcccggcgaatccaagggcgtgggcctgtgcgacgcccctcgcggcgcgctgtcc
cactggattcgcatcaaggacaagaagatcgacaacttccagcttgtcgtgccctccacc
tggaacctcggaccccgcggcgccgcgggcgacaagagcccggtcgaggaagcgctcatc
ggcacccccatcgccgatcccaagcgccccgtcgaaatcctgcgcacggtccacgccttc
gatccctgcatcgcctgcggcgtgcacgtcatcgaacccgagaccaacgaaatcctcaag
ttcaaggttgtctaa

DBGET integrated database retrieval system