KEGG   Desulfovibrio magneticus: DMR_18320Help
Entry
DMR_18320         CDS       T00917                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dma  Desulfovibrio magneticus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DMR_18320 (tpiA)
   01230 Biosynthesis of amino acids
    DMR_18320 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DMR_18320 (tpiA)
   00051 Fructose and mannose metabolism
    DMR_18320 (tpiA)
   00562 Inositol phosphate metabolism
    DMR_18320 (tpiA)
Enzymes [BR:dma01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     DMR_18320 (tpiA)
Exosome [BR:dma04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   DMR_18320 (tpiA)
  Exosomal proteins of bladder cancer cells
   DMR_18320 (tpiA)
  Exosomal proteins of melanoma cells
   DMR_18320 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
2047417..2047923
Genome map
AA seq 168 aa AA seqDB search
MLLDAGCTYALAGHSERRHILGEDDAMVGRKVGFGLKSGLSMILCVGEKVEERKAGELEA
VLRRQIEAGLAEVGADVGPEKLAVAYEPVWAIGTGLTAGPEEVAEAHALVRAMLVERLGA
VGGQIRILYGGSVKQGNAGQLLGIDNVDGVLVGGASLEAGSFAAIVTA
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgctcctggacgcgggttgcacctacgccctggccggccattccgagcgccgccatatc
ctgggcgaggacgacgccatggtcgggcgcaaggtgggttttgggctgaaaagcggcctg
tccatgatcctgtgcgtgggcgagaaggtggaggagcgcaaggccggcgaattggaagcc
gtgctgcgccgccagatcgaggccgggttggccgaggtcggggctgatgttgggccggaa
aagctggccgtggcctatgagccggtctgggctatcggtacggggctcacggccggaccg
gaggaagtggccgaggcccacgccctggtgcgggccatgttggtcgaacgattgggcgct
gtgggcggccaaatccgcattctctacggcggcagcgtgaagcagggcaacgcggggcag
ctattagggattgacaacgtcgacggagtgctggtaggtggcgcaagccttgaggctgga
agcttcgcggcgattgtgacagcttga

DBGET integrated database retrieval system