KEGG   Desulfovibrio magneticus: DMR_18430Help
Entry
DMR_18430         CDS       T00917                                 

Definition
(GenBank) putative chemotaxis CheB/CheR fusion protein
  KO
K13924  two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
dma  Desulfovibrio magneticus
Pathway
dma02020  Two-component system
dma02030  Bacterial chemotaxis
Module
dma_M00506  CheA-CheYBV (chemotaxis) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:dma00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    DMR_18430
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    DMR_18430
Enzymes [BR:dma01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     DMR_18430
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     DMR_18430
Two-component system [BR:dma02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   DMR_18430
Bacterial motility proteins [BR:dma02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    DMR_18430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest CheR PAS_10 PAS PAS_4 CheR_N PAS_9 IncA CENP-F_leu_zip Spc7 AAA_13 HMMR_N Fez1 Exonuc_VII_L Golgin_A5 IFT57 AAA_23 Seryl_tRNA_N Laminin_II IL12 PAS_8 DUF745 DUF4407 HAUS-augmin3 LXG APG6 Rootletin Leu_zip Mod_r ADIP FAP206 Methyltransf_12 DUF812 FapA DUF87 CorA TBPIP DUF3584 COG2 Mnd1 DUF4527 TPR_MLP1_2 DUF3450 DUF2205 Prefoldin_2 Peptidase_S64 DUF16 FAM76 DASH_Duo1 LMBR1 DUF3552 Reo_sigmaC HrpB7 Atg14
Motif
Other DBs
NCBI-ProteinID: BAH75334
NITE: DMR_18430
UniProt: C4XQG9
Position
2056610..2059837
Genome map
AA seq 1075 aa AA seqDB search
MVANEYIYNNIIWLQSIWLLLTLGSRCRTVSLVSNHLKWHDGKIGYNRDCCDIIIFEILC
SHHPQGDRPMAKKKAPPKSKPKTGRDSSVETSATDPVQASGSSFPIIGIGASAGGLAAFE
AFFSGMPTDTDPGMAFVLVQHLAPDHKSILTDLIQRYTRMKVFEVVDGMVVKPNCTYIIP
PNRDMAFIDGALQLLEPSAPRGQRLPIDFFFRSLAQDQGDKAIGIVLSGTGSDGTLGIRA
IKGEGGLVLVQTPETTEYDGMPRSAIGTGLVDYELPPTEMPSKLILYVKQMYDNHGLHKP
HLIIKPDNSLKKIFILLRGQTSHDFSQYKPSTILRRIERRMAVNHIESMEAYVKFLQQTP
SEVAALFRDLLIGVTNFFRDPEAFRILEEQVIPKLFSGKPAGSILRVWTPGCSTGEEAYS
LAILFQEHIEALKQSYKVQLFATDIDSNAIATARNGVYPSTIAADISPERLNRFFSTETG
GGGLRIQKVLRDMLVFSEQNVIKDPPFSKLDLICCRNLLIYLNGDLQKKLIPLFHYALNP
GGYLFLGTSETVGEFGDLFATLDRKQKIYQRKDVFNAQRLPLAQFLPSIAVGDAGAPKST
GKASPVGKLPLRELTEQTLLKQFDPVAALVNDKGVIFYLHGRSGLYLELAPGEVGAVNIF
KIAREGLQRELTTALHRVAKTKELVQCAGLRVKTNGDFATVNMTVRPVAIDNGEEVETNL
YLVILEHVTPAMEAKHEHMTQDAICPETIDDARSDTHVAALKQELRNKEEYLQTTLEELE
TSNEELKSSNEEMQSVNEELQSTNEELETSKEELQSVNEELATVNAELQNKVADLSRANN
DMNNLLAGMGVATVFVDTQLRILRFTPAATQIINLISSDVGRPVQHIVSNLIGYDSLVVD
AQAVLDTLTPKAIDVEAKDGKQYNMRIRPYRTLENMIEGVVISFYDVTELKSAQHLLAVA
NDQLRYVQLGRDARDAVLIMNSDGNILAWNHAAHKAYGWDESDALTMNIRDLIPEEVRDA
ETGKFREIALGKSQGPHASVRLDKSGKRIPVEFATTPLVDEKGRIYAIATLERVV
NT seq 3228 nt NT seq  +upstreamnt  +downstreamnt
ttggttgcgaatgaatatatttataacaatatcatctggctgcaaagtatctggctgctg
ttgacactaggttcaaggtgccgcaccgtttcgcttgtctcaaatcatcttaagtggcat
gatggcaaaataggctacaatcgtgactgttgcgacatcataattttcgagatcttgtgt
tcacatcaccctcagggagatcgtcctatggccaagaaaaaggccccaccgaagtcaaag
cccaagacaggccgagattcttcggtagaaacatctgccacagaccctgtacaggcctct
ggatcatctttccccataatcgggataggtgcttccgcaggagggctggcggcttttgag
gccttcttttctggcatgcctaccgataccgatcctggcatggcctttgtgctggtgcag
catcttgcccctgatcacaagagcatcctcacagatctcattcagcgctatacccgcatg
aaggttttcgaagtggtggacgggatggtggtcaagcccaactgcacctacatcatcccg
cccaaccgcgacatggccttcatagatggcgcgctccaactgctggagccgtctgctccc
cgaggtcaacgtctgcctattgacttcttcttccgctccctggcccaagatcaaggtgac
aaagccattggcatcgtactctctggcacagggagtgacggcaccctgggaattcgggct
atcaaaggtgaagggggcttggttttagtccagaccccagaaacaactgagtatgatggc
atgccccgaagcgccattgggactggcctggttgactatgaattgccgccaactgagatg
cccagcaagttaatcctctatgtaaaacagatgtatgataatcacggtttgcacaagccg
caccttataattaaaccagataactcattaaaaaagattttcattttgttgcgcggtcaa
actagtcacgacttctctcagtacaagccgagcactattcttcggcgcattgaacggcgt
atggctgtcaaccacattgaatcaatggaagcatacgtaaaatttttgcaacaaactcca
tcagaagtggcagcattatttcgtgatctgttgatcggcgtgaccaactttttccgtgat
ccggaagcgttcaggattcttgaggagcaggtcatccccaaactcttctcgggtaagcct
gcgggttccattttgcgagtctggacaccggggtgttccaccggcgaggaagcttattcg
ctcgccatacttttccaagagcacattgaggcgctaaagcagagctacaaggtgcaactc
ttcgccacggacattgacagcaacgcgattgctacggcccggaatggcgtttacccgtcc
acaatcgccgcagacatctcgccggaacgtttgaaccgctttttctcaacagagacaggc
gggggcgggttgcgtatccaaaaggtccttcgcgacatgctggtcttttccgagcagaac
gtgatcaaagaccccccattctccaaactcgacctcatctgctgccgcaacctactcatc
tatttgaacggggacttgcaaaagaagctaatccctctcttccactatgccttgaacccg
ggcggctatcttttcctggggacctctgaaacggtaggcgagttcggcgacctatttgcc
acactggaccggaaacagaaaatttatcaacgaaaagacgttttcaacgcccagcgtttg
ccattggcccaattccttccatcaattgcggtgggggatgcaggcgcgcccaaatcaacg
ggaaaggcatcacccgtcgggaaactgcctcttcgcgagttaactgaacagacactcttg
aagcagttcgaccccgtcgccgcccttgtcaacgacaaaggcgtaatcttctatcttcat
gggcgttccggcttgtatctggaactcgctcccggtgaagttggtgccgtgaacattttc
aagatagcacgcgaagggttgcagcgagaactaaccacagctttgcatagagtagctaag
acaaaagagttagtgcagtgtgcaggtctccgcgttaaaactaatggagatttcgctact
gtcaatatgaccgttcgccccgtggctatagataatggcgaagaagttgaaacaaacctg
tatcttgtcattcttgagcatgttactccagctatggaagcgaagcatgagcatatgact
caggatgcaatatgcccagagacaattgacgatgcgcggagcgacactcatgtagcggcg
ctcaaacaagaactgcgcaacaaggaagaatatctccagacaactttagaggagctagaa
acatcaaacgaagagctaaagtcttctaatgaggagatgcaatctgtcaatgaggagctt
cagtcaacaaacgaagagcttgagacttcaaaagaggaattacaatcagtcaatgaagag
ctggccacggtcaatgccgagcttcagaacaaggttgcggatttgtctcgggctaacaac
gacatgaacaatcttctagccggaatgggtgttgccaccgtatttgttgacactcaactt
cgcatcctacggttcacccccgccgccactcaaatcataaacttgatttcgagtgatgtc
ggacgtcctgttcagcatatcgtttccaaccttattggctatgacagtcttgtggtagat
gcgcaggccgttttggatactctgaccccaaaagccatcgacgtcgaggcgaaggatgga
aagcagtacaatatgcgcatccggccctaccgtacgctcgaaaatatgatagagggcgtg
gtaatctcattttacgacgtcaccgaattgaagagcgcgcagcatctgctcgccgtggcc
aatgatcagctccgctacgtgcagcttgggcgtgatgctcgagatgccgtcctgatcatg
aattcggatggaaatatcttggcctggaatcacgcggctcacaaagcttacggatgggat
gaatccgatgccttgaccatgaacattcgtgacctgatcccggaagaagtacgcgatgca
gagacgggaaaattccgagaaatcgctctaggtaaaagtcagggcccacatgcctcggtt
cgccttgataagagtggaaaacgcataccggtagaatttgcaaccacgcctttggtcgat
gagaaaggccggatttacgctatcgcgacactggaacgagttgtctga

DBGET integrated database retrieval system