KEGG   Desulfovibrio magneticus: DMR_18670Help
Entry
DMR_18670         CDS       T00917                                 

Definition
helicase RecD/TraA family protein
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
dma  Desulfovibrio magneticus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:dma00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    DMR_18670
Enzymes [BR:dma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     DMR_18670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(2095549..2097726)
Genome map
AA seq 725 aa AA seqDB search
MSETQNEFSDLSGQIERVTFTSEESGYTIAKVKVYGRRELVTVVGNILCPTPGEIIKMKG
EWSNHPKFGEQFKLAYYKTTVPASVHGIEKYLGSGLIKGIGPVMAKRIVKLFGEATLDVI
EADIQKLIEVPGIGSKRVGMIAQAWEEQKEIRSVMLFLQTHGVSSGYATKIYKQYKNESI
AVVQENPYRLAHDIFGIGFVTADKIAQKLGFDKNSPLRAEAGILYVLHQLSDEGHVFYPQ
DPLIVKAIEILEVEPGVLVDALGRLATEHKIVAETLDRPDGPVEAIYLAKYHLSENQVAA
RLKALQAAAKGVRSIDAEKAVEWVQEKLSMTLAEKQVEAVKAAATSKVLVITGGPGTGKT
TIIRAILKIFSAITKYILLAAPTGRAAKRMSEATGHEAKTLHRLLEYSMQKGGFQKNEDH
PLDCELIVVDEASMIDLILMHHLLKAIPKPATLILVGDVDQLPSVGAGNVLKDVIASGAV
PVVQLNEIFRQAQESSIIVNAHRINKGVMPDTRPRKDADDFYFVEEEEPERALQRIIQLV
RERIPARFGLDPINQVQVLTPMNRGIVGTTNLNLALQAALNPNGAEVVRGGRTYRVGDKV
MQIKNDYDREVFNGDIGRVTKIDEEEQELTVDIDGRPIIYDFSGLDELVLAYGVSIHKSQ
GSEYPAVVIPVLTQHYVMLQRNLLYTGVTRGKELVVLVGTKKALGIAVRNNKTVSRHTHL
SARLN
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaacgcaaaatgaattttctgatctgagtggccaaatagagagggtcactttc
accagtgaagagagtggctacaccattgccaaggtcaaggtgtacggccgccgcgaactg
gtgaccgtcgtaggcaatatcttgtgccccactccgggcgagatcatcaagatgaagggg
gagtggtccaatcaccccaagttcggagaacagtttaagctcgcctactacaagaccact
gtccccgcgtcagtgcatggaatcgaaaagtaccttggttcgggcctgataaagggcatc
ggcccggtcatggctaaaaggatcgtcaagctgttcggggaggccaccctggacgtcatc
gaggctgacatccagaagcttatcgaggttccgggcatcggctccaaacgggttggcatg
attgcgcaggcctgggaggagcagaaagaaatccgctccgtgatgctgttcctccagacc
cacggggttagctcaggctacgcgacgaaaatttacaagcagtacaagaacgagtcgata
gccgttgtccaggagaacccctaccggctggcccatgacattttcggcatcggcttcgtc
acagcagacaaaatcgcacagaagcttggtttcgacaaaaactctccgctccgggccgag
gctggcatcctgtatgtcctgcaccagctttcggacgaagggcatgttttctatccccaa
gaccccttgatcgtgaaggccatcgagattttggaagtggagcctggagtcctggtggac
gctcttggccggctggctacggagcataagattgtcgccgagacgctggatcggccggac
ggtccggtagaggccatctaccttgccaagtaccacctttccgagaaccaggtcgcagcg
cggctgaaggcgctccaggctgctgccaagggggtccgctccattgacgccgagaaggcc
gtggagtgggtccaggaaaagctgtccatgaccctagccgagaagcaggtggaagcggtg
aaggccgccgctacaagcaaagtcctggtcatcactggcggaccggggacgggcaaaacg
acaattatccgagccatcctgaaaatcttctcagctatcaccaagtatatcctgttggcc
gccccgactggccgggcggcgaagcgcatgtctgaagccacgggacacgaggctaaaacg
ctccacaggttgcttgagtattccatgcagaaaggcggattccagaagaacgaggaccat
cccctcgactgcgagctaatcgtcgtggacgaagcgtccatgatcgacttgatcttgatg
caccatctgctgaaggcgattcccaagccggccaccttgatcctggtcggtgacgtggac
cagttgccttcggtcggcgcgggaaatgtgctcaaggacgtgatcgcttcgggagccgtc
ccggtagtgcaactgaacgaaattttccggcaggcacaggaatcctcgattatcgtaaat
gcccacaggatcaacaaaggcgtcatgccagacacccgcccccgcaaagatgctgacgac
ttttacttcgtcgaggaagaagagcctgagagggcactgcaaaggatcatccagttggtc
cgggagcgaatcccggcgcggtttgggcttgaccccatcaatcaggtccaagtgctgacg
cccatgaaccgagggatagtcgggacgaccaatctgaatttggcgcttcaggcagcattg
aaccccaacggggcagaggtagtccggggcgggcgcacttaccgagtcggggataaggtc
atgcaaataaagaatgactacgaccgggaagtctttaacggggatattggcagggtcaca
aagattgacgaggaagagcaggaattgactgtggacattgacggcaggccgataatttac
gatttctctggtcttgatgagcttgttttagcttacggtgtgtcgattcataagtcgcaa
gggtcagagtaccctgcggttgtaattcctgtgctgacgcagcactatgtgatgcttcaa
cgcaatttgctgtacactggtgtcactcgggggaaagagcttgtcgtcctcgtgggaacc
aagaaagctcttggcattgctgtcagaaacaataagactgtttctcgccatacacatttg
tcagcccgattgaattga

DBGET integrated database retrieval system