KEGG   Desulfovibrio magneticus: DMR_19490Help
Entry
DMR_19490         CDS       T00917                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
dma  Desulfovibrio magneticus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dma00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    DMR_19490 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DMR_19490 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DMR_19490 (trpB)
Enzymes [BR:dma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     DMR_19490 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
2184154..2185509
Genome map
AA seq 451 aa AA seqDB search
MENCMEMKINLPEAEMPTQWYNALPDLPTPLAPPLDPQTKEPVTPEQLEVIFPKAVIEQE
MSPQRWLPIPQPVLDVYRLYRPTPLVRAKRLEEALGVKCKIYYKNESVSPAGSHKPNTAI
PQAYYNKAEGVRRLATETGAGQWGTALSFACSMLDMECTVYMVKVSYDQKPYRRILINAY
GGEVFASPSPRTQTGRAMLESDPDCTGSLGLAISEAVEDAATHADTKYALGSVLNHVLHH
QTIIGLEVEKQLAMVGDKPDYLVGCVGGGSNFAGLVLPFLPRKLAGEAIEFIAVEPQACP
TLTKGQFRYDYGDVAKLTPLLKMHTLGHAFMPAPIHAGGLRYHGDAPIVCNLAAEGLVNA
QAYYQTECFEAAKLFLRTEGFLPAPETSHAIKGAIETAKKAKPGESVVFLYSGHGLLDLA
SYDAFLQGKLSDFAYPEEHIAEALKACPTVG
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
gtggagaattgcatggagatgaagatcaatctgcctgaggcggagatgccgacgcagtgg
tataacgccctgcccgatctgcccacgcccctggcgccgccccttgatcctcagaccaag
gagcccgtgacccccgaacagctggaagtcatcttccccaaggccgtcatcgaacaggaa
atgtcgccgcagcgttggctgcccattccccagccggtgcttgacgtctaccgcctctac
cggcccaccccccttgtgcgcgccaagcgtctggaagaagctctcggggtcaagtgcaag
atctattataaaaacgaatccgtttcgccggccggctcccacaagcccaacaccgccatc
ccccaggcctattacaacaaggccgaaggcgtgcgccggctggccaccgaaaccggggcc
ggccagtggggcacggccctgtctttcgcctgttccatgctggacatggaatgcacggtc
tatatggtgaaggtgagctacgaccagaaaccgtatcggcgcatcctcatcaacgcctac
ggcggcgaagtctttgcctcgccctccccgcgcacccagaccggccgggccatgctcgaa
agcgaccccgattgcaccggttcgctggggctggccatctccgaagccgtggaagacgcc
gccacccacgccgacaccaagtacgccctgggcagcgtgctcaaccacgtgctgcaccat
cagaccatcatcggtcttgaagtcgagaagcaactggccatggtcggcgacaagccggat
tacctggtcggctgcgtgggcggcggcagcaacttcgccggcctggtcctgccgtttttg
ccgcgaaagctggccggcgaggccatcgagttcatcgccgtggagccgcaagcctgcccg
accctgaccaaggggcagttccgctacgactacggcgacgtggccaagctcacgcccctg
ctcaagatgcacaccctcggccacgccttcatgccggcccccatccatgccggcgggctg
cgctaccacggcgacgcgcccatcgtgtgcaatctggccgccgaagggttggtgaacgcc
caggcctactaccagaccgagtgtttcgaggcagccaagctgttcctgcgcaccgagggc
tttctgcccgcgccggagacctcccatgccatcaagggcgccatcgagaccgccaagaag
gccaagcccggcgagtcggtggtgttcctctattccggccatggcctcctcgatctggcg
tcctacgacgcctttttgcagggcaaactctccgacttcgcctatcccgaagagcatatc
gccgaggctctcaaggcctgcccgaccgtcgggtaa

DBGET integrated database retrieval system