KEGG   Desulfovibrio magneticus: DMR_19670Help
Entry
DMR_19670         CDS       T00917                                 

Gene name
acs
Definition
acetyl-coenzyme A synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
dma  Desulfovibrio magneticus
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:dma01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dma00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:dma00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:dma00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:dma00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
2203124..2204821
Genome map
AA seq 565 aa AA seqDB search
MHRQDNNRFARESKTMPVAKLRPKSYRELLETFSIAVPENYNFAFDFLDAEAAQDPTRPA
MIHIGPDGTRRDLDLAYFSKESARMANAFKAAGLAKGDKVMIILYRRVEWWVTMLALHKL
GAVPVPSPNLLTPHDIDFRVNYAGIKAVVAEDSVVDRVEAARAACPTLTVCVQVGASPLP
AGWLDYETIRAAAAEDFPRTAEAPGGDDSLLIFFSSGTTGMPKMVEHSHAYPLGHLTTGV
YWHNLEPGDVHLTLADTGWGKAVWGKFYGQWMAGATVFTWDFRGKFVPSELLDVMTAHKV
TSFCAPPTVYRFLIREDLKKYDLSALRYCTTAGELLNDGVFRAWKEITGLSIYEGYGQTE
TCLQLATFPCMTPKPGSIGRPTPGWNVVILDEEGKPCPAGVEGEICLKLEDGKNLGLFTG
YLQEPAKTASVMVDGYYHTGDKAWMDEDGYFWFLGRTDDLIKSSGYRIGPFEVESALITH
KAVVEAAVTGVPDPVRGQAVKATVVLAPGYTGSPELAKELQEHVKKETAPYKYPRIIDFV
AELPKTISGKIKRAEIRAKDESREI
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
gtgcatcgacaagacaacaaccgttttgcccgggagtccaagaccatgcctgtcgccaaa
ctgcgacccaaatcctaccgtgagctgctcgagacattttccatcgctgtgcccgagaac
tataatttcgccttcgattttctcgacgccgaggccgcccaggacccgacccggccggcc
atgatccacatcggcccggacggaacccggcgcgatcttgatctggcctatttcagcaag
gaatcggcccgcatggccaatgccttcaaggccgcgggactcgccaagggcgacaaggtg
atgatcatcctctaccgccgggtggagtggtgggtcaccatgctggccctgcacaagctc
ggggccgtgcccgtgccctcgcccaacctgctcaccccccacgacatcgatttccgggtc
aactacgccggcatcaaggccgtggtggccgaggattccgtggtcgaccgggtggaagcg
gcccgggccgcctgcccgaccctgaccgtgtgcgtccaggtcggcgcgtctccgctgccg
gccggctggctcgactacgaaaccatccgcgccgccgccgccgaggatttcccccgcacc
gccgaggccccgggcggcgacgattcgctgctcatcttcttctcctccggcaccaccggc
atgcccaagatggtggagcacagccacgcctatcccctgggccacctcaccaccggcgtc
tactggcacaacctggagcccggcgacgtccacctcaccctggccgacaccggctggggc
aaggccgtgtggggcaagttctacggccagtggatggccggagccacggtcttcacctgg
gatttccggggcaagttcgtgccctccgagcttctcgacgtcatgaccgcccacaaggtg
acctccttttgcgccccgcccacggtctaccggttcctcatccgcgaggacctcaagaag
tacgacctctcggcgctgcgctactgcaccaccgccggcgaactcttaaacgacggcgtg
ttccgggcctggaaggaaatcaccggcctttccatctacgaaggctacggccagaccgaa
acctgcctgcaactggccactttcccctgcatgacgcccaaacccggctccatcggccgg
cctaccccgggctggaacgtggtcatcctcgacgaggaaggcaaaccctgcccggccggg
gtggagggcgaaatctgcctcaagctcgaagacggcaagaacctgggcctgttcaccggc
tacctccaggaaccggccaaaaccgccagcgtcatggtcgacggctactaccataccggc
gacaaggcttggatggacgaagacgggtacttctggttcctgggccgcaccgacgacctc
atcaagtccagcggctaccgcatcggacccttcgaggtcgaaagcgcgctcatcacccac
aaggccgtggtcgaggccgccgtcaccggcgtgcccgatcccgtgcgcggccaggccgtc
aaggccacggtcgtcctggctcccggttacaccggctccccggaattggccaaggaactg
caagagcacgtgaaaaaggaaaccgcgccctacaagtacccgcgcatcattgatttcgtc
gccgagctgcccaagaccatcagcggcaagatcaaacgcgccgagatccgcgccaaggac
gaaagtcgggaaatataa

DBGET integrated database retrieval system