KEGG   Desulfovibrio magneticus: DMR_21560Help
Entry
DMR_21560         CDS       T00917                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
dma  Desulfovibrio magneticus
Brite
Enzymes [BR:dma01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     DMR_21560 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
2431022..2431729
Genome map
AA seq 235 aa AA seqDB search
MARGRMLPRERKLMNATGVKTDLRRSRERMVREQIEARGVTRPEVLRAMRKTPRHLFVEE
ALIPQAYEDHPLPIGHGQTISQPYVVAWMTELLEVAPGHKVLEIGTGSGYQAAVLAELGA
EVYTVERIKPLYEQARARLDALRYDRVQLKLDDGTLGWPEKAPFDRILVAAGGPKIPAPL
VAQLGPAGRMVIPVGTSRRNQTLCLVRRDNGRVIVRDLGGVMFVDLVGTHGWQAS
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atggcgcggggaaggatgcttccccgtgaaaggaaactgatgaacgccactggggtcaag
accgatttgcggcgcagccgggaacgcatggtgcgggaacagatcgaggcccggggcgtg
acccggcccgaggtgctgcgggccatgcgcaagacgccgcgccaccttttcgtcgaagag
gcgctcattccccaggcctacgaggaccacccgctgcccatcggccacggccagaccatt
tcccagccctatgtcgtggcctggatgacggaactgcttgaggtcgccccgggccacaag
gtcctggagatcggcacgggttcgggctatcaggccgccgtgctggccgaactcggcgcc
gaggtttataccgtggagcggataaagcccctctatgaacaggcccgggccaggctcgac
gccttgcgctacgaccgggtgcagcttaaacttgacgacggcaccctgggctggcctgag
aaggctccttttgatcgaatactggtggccgccggagggcccaagattccggccccgctg
gtggcccagctcggcccggccgggcgcatggtcataccggtggggacttcgcggcgaaac
cagaccctgtgcctggtgcgccgggataacggccgggtcatcgtgcgcgatctcggcggg
gtcatgttcgtcgacctcgtcggaacccacggctggcaggcttcgtga

DBGET integrated database retrieval system