KEGG   Desulfovibrio magneticus: DMR_22040Help
Entry
DMR_22040         CDS       T00917                                 

Gene name
hisD
Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
dma  Desulfovibrio magneticus
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dma00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    DMR_22040 (hisD)
  Amino acid metabolism
   00340 Histidine metabolism
    DMR_22040 (hisD)
Enzymes [BR:dma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     DMR_22040 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
2476203..2477507
Genome map
AA seq 434 aa AA seqDB search
MPCPRFTVTGPADFGALRALLATREEAAGDAEEKVRRILADVAERGDAALVELTRDFDCK
TFDASCLRVPAADIEAGKNAVPAADLAIIEEAAANIRDFHERQKEQSWWVPSPGGTMLGQ
IVTPVDAAGCYVPGGRGGETPLISSLLMNAIPAAVAGVPRIVAVSPPRADGTLNPYILAA
AAVCGVTEIYRLGSAWAVAALAYGTDAITPVDVVVGPGNIYVTTAKRLLIGRIGIDMIAG
PSEIAILADSTANPEWLAADMLSQAEHDPMAAAVCISDDKALLDATCAELAKQVAALPRN
DIAAASLSHYGALVAVPDIDVGMELINTIAPEHFELCVADPWVLVGKVRHAGAVFMGHHC
PEPVGDYFAGPNHVLPTMGTARFSSALSVSTFTKKTSLIAAAPGYVAANGPKIARLARLE
NLEAHARSVECRLK
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgccctgtccccgctttaccgtcaccggtccggccgatttcggggcgcttcgcgccctg
ctcgccactcgcgaggaggcggccggcgacgccgaggaaaaagtccgccgcatcctggcc
gacgtggccgagcgcggcgacgccgccctggtggaactgacccgcgatttcgactgcaag
accttcgacgcctcctgcctgcgcgtgccggccgccgacatcgaggccggcaagaacgcc
gtccccgccgccgacttggccatcattgaggaagccgcggccaacatccgggacttccat
gagcgccagaaggaacagtcctggtgggttccgtccccgggcggcaccatgctcggccag
atcgtcaccccggtggacgccgccggttgctatgtgcccggcgggcgcggcggcgaaacg
ccccttatttcgagcctgctcatgaacgccatcccggccgccgtggccggcgtaccccgt
atcgtggccgtgtccccgccccgggccgacggtacgctcaatccctacatcctggccgcc
gccgccgtgtgcggcgtcaccgagatctaccgtctgggcagcgcctgggccgtagccgcc
ctggcttacggcaccgatgccattaccccggtggacgtggtggtcgggccgggcaacatc
tacgtcaccacggccaagcgcctgctcatcggccgcatcggcatcgacatgatcgccggg
ccaagtgaaatcgccattctggccgattccacggccaaccccgaatggctggccgccgac
atgctgtcccaggccgagcacgatcccatggccgccgccgtgtgcataagcgacgacaag
gccctgcttgacgccacttgcgccgagttggccaaacaagtggctgccctgcccagaaac
gacatcgccgccgcctccctgtcccactacggagcgctagtcgccgtgcccgatatcgac
gtcggcatggaactcataaacaccatcgcgcccgagcatttcgagctgtgcgtggccgat
ccctgggtcctggtcggcaaggtgcgccatgccggcgcggtatttatgggccaccactgc
cccgagccggtcggcgactatttcgccggccccaaccacgtgctgccgaccatgggcacg
gcccggttctcctcggccctgtccgtgtccaccttcaccaagaaaaccagcctcattgcc
gccgccccgggctacgtggccgccaacggccccaagatcgcccggctggccagactcgaa
aatctcgaagcccacgcccgcagcgtggaatgccgtttgaaataa

DBGET integrated database retrieval system