KEGG   Desulfovibrio magneticus: DMR_22830Help
Entry
DMR_22830         CDS       T00917                                 

Definition
aldehyde ferredoxin oxidoreductase family protein
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
dma  Desulfovibrio magneticus
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DMR_22830
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    DMR_22830
Enzymes [BR:dma01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     DMR_22830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
2559853..2561637
Genome map
AA seq 594 aa AA seqDB search
MSNEANDLFRVLVYDLERGRGELAILPGRRQCLGGSGLAALLYEKYGLPTAPAFDPRQPL
IFAIGPATGYFPLMSKTVCGFKSPYNENYAESHAGGRSALALRFAGYDALVVVGKAPRLS
TLVVGSRRIERIDVHYLAGADVFTTGKLLRKIAEGASGHRSILRIGPAGENGSGYACINV
DTYRHFGRLGAGAVMGSKNLKGIVIQGDGDLPLPADKGYAKLFKDIHEKVTSSGMMEKYH
NLGTPANVLPLNELKSLPWRNLAATSDSEADKISGEAFAEKLLMHNAACAGCPVGCIHVG
MVREMFSSSHRFAIHQVAYDHEPNFAAGPMLGVVDPVEVLAINDMADRQGLDIISAGVAL
AWAVEATQKGVISEKDTEVKLTFGDAAALKRAMWLIGHKANDFYALLGQGAMVAAAHYGG
ADYACVLGQEMAGYATGETYFASQTVAFRHSHLDTGAYSYDQKHKEQDVAKVVDFLVKDE
RERVLLTCLVACLFAREVYKPEVIASVLGCLGHEELAGSFDAAAENARRARWRLKIATGY
DPRATRIPKRFTEVTTWKGPVDAVYMEALRAAYAEAVAELGAPPATDQAQPPAL
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaatgaggcaaacgatctgttccgcgtcctggtgtatgacctcgaacgcggtcgc
ggcgaattggccatcctgcccggtcggcggcaatgcctcggcggctcggggctggcggcg
ctcctttatgaaaaatacggcctgcccacggccccggccttcgatccccgtcagccgctg
atattcgccattggtccggccacgggctatttcccgctcatgagcaagaccgtgtgcggc
ttcaaatcgccatataacgaaaactacgccgaatcccacgccggcggccgctcggccctg
gccctgcgctttgccggctacgacgccctggtcgtggtgggcaaggccccacggctctcc
accctggtggtcggctcgcggcgcatcgaacgtatcgacgtccactatctggccggggcc
gacgtgttcaccacaggcaagctcctgcgaaagatcgccgagggggcttcgggccaccgc
agcattctacgcatcggcccggccggagaaaacggctcgggctacgcctgcatcaacgtc
gacacctaccgccacttcggccgcctcggagccggggcggtcatgggctcgaaaaacctc
aaaggcatcgtcatccagggcgacggcgacctgccgctgccggccgacaagggctatgcc
aagcttttcaaggacatccacgaaaaggtcacatcctccgggatgatggaaaaataccac
aaccttggcaccccggccaacgtgttgcccttaaacgaactcaagtcgctgccctggcgc
aacctggccgcgacgagcgattccgaggccgacaagatctcgggcgaggcctttgccgaa
aagctcctcatgcacaacgctgcctgcgccggctgtccggtgggctgcatccacgtcggc
atggtgcgcgagatgttctcctcttcccaccggttcgccatccatcaggtggcctacgac
cacgaacccaacttcgcggccggccccatgcttggcgtcgtcgatccggtggaagtgctg
gcgataaacgacatggccgaccgccagggcctggacatcatctcggccggcgtggccctg
gcttgggccgtggaggccacgcaaaagggcgtcatttccgaaaaggacaccgaggtgaag
ctcacctttggcgacgcggctgccctcaaacgcgccatgtggctcatcggccacaaggcc
aacgacttctatgcgctccttggccagggggccatggtcgccgccgctcattacggcggg
gccgactacgcctgcgtgctgggccaggaaatggccggctacgccacgggcgagacctat
tttgcctcccagaccgtcgccttccgccattcccacctcgataccggggcctactcctac
gaccagaagcacaaggagcaggacgtggccaaggtggtggacttcctggtcaaggacgag
cgcgagcgagtgcttctgacttgcctcgtggcctgccttttcgcccgggaggtctacaag
cccgaagtcatcgcctcggtgctcggctgcctgggccatgaggaactggccggctccttt
gacgccgccgccgagaatgcccggcgcgcccgctggcggctcaagatcgccaccggctac
gaccccagggccacgcgcatccccaaacgcttcaccgaggtgaccacctggaagggtccg
gtggacgcggtctacatggaggccctgcgggccgcctacgccgaggccgtggccgaactc
ggcgcgccgcctgccaccgaccaggcccagccgccggctttgtaa

DBGET integrated database retrieval system