KEGG   Desulfovibrio magneticus: DMR_25620Help
Entry
DMR_25620         CDS       T00917                                 

Definition
beta-N-acetylhexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
dma  Desulfovibrio magneticus
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dma00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    DMR_25620
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    DMR_25620
Enzymes [BR:dma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     DMR_25620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
2857452..2859158
Genome map
AA seq 568 aa AA seqDB search
MVLCRFFVWLLSILLACAATPVEASAASRTARLAGEMTLEEKVGQVFMVWFAGPAVSDDI
AGLIRQRHLGGVILYGVPGNIESPGQLAALNAGLQAVSAATRHGLGLLIGVDQEGAPVAR
LRKGFTLFPSQMAQAATGRADLARLAASATARELRAVGINVNFAPVADVNVNPANPVIGI
RSFGSAPADVARFTGAATAGYGAAGMICTPKHFPGHGDTTIDSHVGLPRSDHDAAALDKL
DFPPFRAAFAAGAPAVMTAHMVVPALDGEPDLPATLSRRVLEGTLRGRMGFDGVIFTDSL
GMGAVADTYGIPEASVRALAAGADVLLVGADAGRSPGERLAAMDAVAEAVRSGRVPMARL
NAAVGRVLRLKERYGLLDAAALANPVPDPVSQIGRPEDAVLARRIARRSLTAVGPTSPAL
PLPAESCLVIRPRLGREAVDAEAEAAIAAWAGPRALFLPADPDDAAMAEALDKAAQAGNV
VFLATDLRRRPGQERLVRELAAKAGRGFVLVAAQSPYDLALVPQSGARLATYGEAPASLE
ALYQGLFAPFRFSGRLPAVLPATALKQQ
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atggttctttgccgctttttcgtctggctgttgtccattctccttgcttgcgccgcgacc
ccggtcgaggcctcggccgcgtcccgaaccgcccggctggccggggagatgaccctggag
gaaaaagtcggccaggtgttcatggtctggttcgctggcccagccgtttccgacgacatc
gccggtctgatccggcagcgccatctcggcggcgtcatcctctacggcgtcccgggcaac
atcgaatctccgggccaactggccgccttaaacgccggcctccaggcggtgtccgccgcc
accaggcatggcctgggcctgttgatcggcgtggaccaggaaggcgcgcccgtggcccgg
ctgcgaaaaggcttcaccctcttccccagccagatggcccaggccgccactggcagggcc
gatctggcccgcctggccgcctcggccactgcccgggaattgcgggctgtgggcatcaac
gtcaatttcgcgcccgtggccgacgtcaacgtcaatccggctaatccggtcatcggcatc
cggtcctttggctccgcgccggccgacgtggcccgtttcacgggagcggccacggccggc
tacggcgccgccggcatgatctgcacgcccaaacatttccccggccacggcgacacgacc
atcgattcccacgtcggcctgccgcgctcggaccatgacgccgccgccctggacaagctt
gattttccgcccttccgggccgctttcgccgctggcgcgccggcggtcatgaccgcccac
atggtcgtcccggccctggacggcgaacccgacctgccggccaccttgtcgcgccgggtc
ctggaggggacgcttcgcggccgcatgggttttgacggcgtcattttcacggattccctg
ggcatgggggccgtggccgacacctacggcatccctgaagcctcggtacgggccctggcc
gccggggccgacgtgctgctcgttggcgcggacgccggccgctcaccaggcgaacgcctg
gccgccatggacgccgtcgccgaggccgtgcgctcggggcgcgtgcccatggcccggctc
aacgccgccgtggggcgtgtccttcgcctcaaggaacgctacggcctgttggacgccgcc
gccctggccaatcccgttcccgacccggtcagccagatcggccgccccgaagacgccgtg
ctggcccggcgcatcgccagacgcagcctcacggccgttggcccgacaagccccgccctg
cccctgcctgccgagagctgtctggtcatccggccgcgccttggccgcgaggccgtggac
gctgaagccgaagcggccatcgccgcctgggccgggccgcgcgcgctctttttaccggcc
gatcccgatgacgcggccatggccgaggccctcgacaaggcggcccaggccggcaacgtc
gtttttttggccacggacctgcgccgccggccggggcaggaacggctggtccgggagttg
gccgccaaggccggccgcgggttcgtgctggtggcggcccagtcgccctacgatctggcc
ctggtcccgcagtccggggcgcggctagccacctacggcgaagctcctgccagtctggag
gcgctttatcagggcttgtttgccccctttcgcttctcgggccgcctgcctgccgttttg
ccggctacggccctcaaacaacaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system