KEGG   Desulfovibrio magneticus: DMR_25690Help
Entry
DMR_25690         CDS       T00917                                 

Gene name
gtaB
Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
dma  Desulfovibrio magneticus
Pathway
dma00040  Pentose and glucuronate interconversions
dma00052  Galactose metabolism
dma00500  Starch and sucrose metabolism
dma00520  Amino sugar and nucleotide sugar metabolism
dma01100  Metabolic pathways
dma01130  Biosynthesis of antibiotics
Module
dma_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dma00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    DMR_25690 (gtaB)
   00052 Galactose metabolism
    DMR_25690 (gtaB)
   00500 Starch and sucrose metabolism
    DMR_25690 (gtaB)
   00520 Amino sugar and nucleotide sugar metabolism
    DMR_25690 (gtaB)
Enzymes [BR:dma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     DMR_25690 (gtaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3 SpoVAE
Motif
Other DBs
NCBI-ProteinID: BAH76060
NITE: DMR_25690
UniProt: C4XU38
Position
complement(2869950..2870822)
Genome map
AA seq 290 aa AA seqDB search
MEIKKVVIPVAGWGTRSLPATKNIPKEMLPVYNKPVVQYVVEEAQASGLQDVVFVTNRNK
TIIEDHFDYNLTLEDLLTRTNKTEMLKMVREVAEMVNIISVRQKKQLGLGHAVLCAREVC
KNDPFAVMVGDDLMFSMEPGIKQLLTVAMTEHMPVIGVMEVPPHMVSRYGIIDGEEFAPG
MYRVRDLVEKPKVNEAPSRLAIVGRYVLFPDIFYHLEKVTPGHGGEIQLTDALKGLAGNN
RLLAVKIQGQRFDAGDWVDYLTANIYFALHDEVLRESLVPRLRELLPFGN
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggaaatcaagaaggtggtcattcccgtcgccggatggggtacgcggtccttgccggcc
acgaagaacatccccaaggaaatgctgcccgtctacaacaaacccgtcgtgcagtacgtg
gtcgaggaagcgcaagcctcggggcttcaggacgtggtgttcgtcaccaaccgcaacaag
accatcatcgaagaccacttcgattacaacctcaccttagaggatctgctcacccgcacc
aacaagaccgagatgctcaagatggtccgggaagtggcggagatggtcaacatcatttcc
gttcgtcagaaaaagcagctgggcctggggcatgccgtgctgtgcgcccgcgaggtctgc
aagaacgatccctttgccgtcatggtcggcgacgacctcatgttcagcatggaaccgggc
atcaagcagctcttgaccgtggccatgaccgagcacatgccggtcataggcgtcatggaa
gttccgccgcacatggtttcccgctacggcatcatcgacggcgaggaattcgccccgggc
atgtaccgggtgcgcgatctggtggaaaagcccaaggtcaacgaagccccgtcgcggctg
gccatcgtcggccgctatgtgctgttcccggacatcttctaccacctggagaaggtcacc
ccgggccacggcggcgagattcagctcaccgacgccctcaaaggcttggccggcaacaac
cgcctgctcgccgtcaagattcagggccagcgcttcgacgccggcgactgggtcgactac
ctcaccgccaacatctacttcgccctgcacgacgaggttctgcgcgagtccctggtgcct
cgcctgcgtgagcttttgccgtttggcaactag

DBGET integrated database retrieval system