KEGG   Desulfovibrio magneticus: DMR_25730Help
Entry
DMR_25730         CDS       T00917                                 

Gene name
folP
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
dma  Desulfovibrio magneticus
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dma00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    DMR_25730 (folP)
Enzymes [BR:dma01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     DMR_25730 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(2874093..2875004)
Genome map
AA seq 303 aa AA seqDB search
MRPTMRQIRSTAPISGPGDSMEQDMASIWRLGGGRTLDCSGDRVIGIVNATPDSFYDGGR
HGDVAAAVSHGLRLAGEGADMLDIGGESTRPGAAPVTDAEEIDRVVPVIAELARRLPDMP
IAVDTYRAGCATAALAAGACAVNDVSGLAFDPALLEVVAQRQPGYVLMHTKGRPDVMQRD
PRYDDVIGEILAYFEQGLTRLTRAGLPEDHVVLDPGIGFGKLSEHNLEILRNLERFTVFG
RPVYLGLSNKSFFGALLGLPVGERTVATAVASALCAGRGARLHRVHDVAAVKQALGLAAA
LAG
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgcggcccaccatgcgacagatacgttccactgcgcccataagcggccctggcgactcc
atggagcaggacatggcctcgatctggcggttgggcggcgggcggaccctggactgctcc
ggggaccgcgtcattggcatcgtcaacgccacgcccgactccttctacgacggcggccgc
cacggcgacgtggcggccgccgtatcccatggcctgcgtctggccggggaaggggccgac
atgctcgacatcggcggcgagtccacccgccccggggccgcgcctgtcaccgacgccgaa
gaaatcgaccgggtcgtgccggtcatcgccgagcttgcccgccgactgccggacatgccc
attgccgtggacacctaccgggccggctgcgccaccgccgccctggccgccggagcctgc
gcggtcaacgacgtgtcggggctggctttcgatccggcgctgcttgaggtcgttgcgcag
cgccagcccggctacgtgctcatgcataccaaaggccggcctgacgtcatgcagcgcgac
ccccgttacgacgatgtaatcggcgaaatcctggcctatttcgaacaggggctcacgcgc
ctgactcgggccgggctgcctgaggaccatgtggtccttgatcccggcatcggtttcggc
aagctctcggagcacaatctggaaattttgcgcaatcttgaacggtttacggtctttggc
cggccggtctatctcgggctgtccaacaagtcgtttttcggcgcgctccttgggctgccc
gtgggcgagcgcaccgtggccacggccgtggcctcggccctgtgcgccgggcgcggggcg
cgcctgcaccgcgtccacgacgtcgccgccgtcaaacaagccctgggcctggccgccgcc
ctggccggctga

DBGET integrated database retrieval system