KEGG   Desulfovibrio magneticus: DMR_26040Help
Entry
DMR_26040         CDS       T00917                                 

Definition
diaminopimelate aminotransferase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
dma  Desulfovibrio magneticus
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:dma01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:dma00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
2911034..2912257
Genome map
AA seq 407 aa AA seqDB search
MLDDLLAHIDGEREAVIDLQRELTAIPALGPDNGGPGEREKADRLKVLLAGMGFPEVREI
NAPDPRVPCGHRPNLAVVMPGADTSRTFWVISHLDIVPPGDRALWKNDPYTLSVDGDLVY
GRGVEDNQQAVVSSILLGRAIAAKKLLPPMNYGMLFVADEETGSKYGLDYVAAHHDGLFS
KDDLFLVPDFGLPTSEMVEVAEKSMLWLKVIVEGRQCHASTPAEGVNTLAAASLFILKIP
KLYDKFGDKDPLFHPANSTFEPTKKEANVENINTIPGRDVFYVDCRVLPHYNLDDVLAAI
AGYGKEVEEACGVTVSYEIVQKEQAAPATDVSATIVTRVMDGIRQVYGADPKPMGIGGGT
VAAYLRRRGYPAVVWATLEHNAHQPNERSSIAKTIGDAKVMARVLYS
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgctagacgacttgctggcccatatcgacggcgaacgcgaggccgtcatcgacctgcaa
cgcgaattgaccgccatccccgccctgggccccgacaacggcggccccggcgaacgcgaa
aaagccgaccgcctcaaagtcctgctggccggcatgggcttccccgaagtccgcgaaata
aacgctcccgatccccgcgtgccctgcggccaccggcccaacctcgccgtggtcatgccc
ggggccgacacctcgcgcaccttctgggtcatctcccacctcgacatcgtgccgcccggc
gaccgcgccctgtggaagaacgatccctacacgctgtccgtcgatggcgacctcgtgtac
gggcgcggtgtcgaggacaaccagcaggccgtggtcagctccatcctgctcggtcgggcc
attgccgccaaaaaactgctgccgcccatgaactacgggatgctgttcgtggccgacgaa
gaaaccggcagcaagtacggcctggactacgtggccgcccaccacgacgggcttttttcc
aaggacgacctcttcctcgtgcccgacttcggtctgcccaccagcgaaatggtggaagtg
gccgaaaaaagcatgctctggctcaaggtcatcgtcgaaggccgccagtgccacgcctcc
accccggccgaaggcgtcaacaccctggccgccgcttcgctttttatcctcaagattccc
aagctctacgacaagttcggcgacaaggacccgctgttccatccggccaactccaccttc
gagccaaccaagaaagaagccaacgtcgaaaacatcaacaccatccccggccgcgacgtc
ttctacgtcgactgccgcgtgctgccccattacaacctcgacgacgtcttggccgccatc
gcgggctacggcaaagaagttgaggaagcctgcggcgtcaccgtcagctacgagatcgtg
caaaaggagcaagccgcgccagccaccgacgtctcggccaccatcgtcacccgggtcatg
gacggcatccggcaggtctacggagccgaccccaaacccatgggcatcggcggcggcacc
gtcgccgcctacctgcgccgccggggctacccggccgttgtctgggccaccctggaacac
aacgcccatcagcccaacgaacgttccagcatcgccaagaccatcggcgacgccaaggtc
atggcgcgggtgttatatagttaa

DBGET integrated database retrieval system