KEGG   Desulfovibrio magneticus: DMR_26930Help
Entry
DMR_26930         CDS       T00917                                 

Definition
malate synthase G
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
dma  Desulfovibrio magneticus
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DMR_26930
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    DMR_26930
   00630 Glyoxylate and dicarboxylate metabolism
    DMR_26930
Enzymes [BR:dma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     DMR_26930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(3012669..3014843)
Genome map
AA seq 724 aa AA seqDB search
MTERVAVAGLSVEKTLYDVFAGEILPATGIAAEAFFAALAGLVAELGPKNRALLAKRDVM
QAAIDVWHKERHGQPHDGDAYDCFLTGIGYLLPEGPDFAIETTGVDPEIATIAGPQLVVP
ITNARYAVNAVNARWGSLYDALYGTDVIPETGGAAKGPGYNPGRGAAVVAYAASFLDMAV
PLAFGRHADVTAYAVLDGVLTVTFADGRMTGLARLDQFAGYAGPAKAPTAVALVKNGLHI
ELRFDRSHPVGAASPSGLKDVVLESALTTILDCEDSVAVVDGPDKAQAYRNLLGLFRGEL
EATFEKGGKTLARAMADDKTFTAPDGGKLVLPGRSLMLVRNVGHLMTTDAVLDAAGEEIP
EGFLDALATAAVALHDQRDLGRKRNSRHGSVYIVKPKMHGPEEVAFACEIFERVERALSM
PPRTLKIGIMDEERRTSLNLKECVRAAKDRIIFINTGFLDRTGDEIHTVMEAGPVVGKNA
MRSQAWMAAYEDGNVDVGLSCGFSGKGQIGKGMWAKPDRMAEMVAAKIDHPKAGANCAWV
PSPTAATLHAMHYHAVDVFARQRELAGRTPANRLDLLKLPVLPAGEAPSPEDKKREIETN
CQSILGYVSRWVDQGIGCSKVPDLDDVGLMEDRATLRISSQHLANWLRHGLCTPEEVEAT
LARMAAVVDRQNALDPAYRPMAADLENSLAFQAARELIFEGINQPNGYTEPILTARRRQA
KARG
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagcgcgtggccgttgccggcctgtccgtcgaaaagaccctatatgatgttttc
gcgggggaaatcctgcccgccaccggcatcgccgccgaggccttttttgccgccctggcc
gggctggtggccgagcttggccccaaaaaccgcgctttgctggccaaacgcgacgtcatg
caggccgccatcgacgtctggcacaaggaacgccacggccagccccacgacggcgacgcc
tacgactgtttcctgaccggcatcggctacctgctgcccgaaggccctgattttgccata
gaaaccaccggcgttgatcccgagatcgccactatcgccgggccgcagttggtcgtgccc
atcaccaacgcccgctacgccgtcaacgccgtcaacgcccgctggggcagcctctacgac
gcgctctacggcacggacgtcattcccgagaccggcggcgcggccaaggggccgggctac
aatcccgggcgcggcgcggccgtcgtcgcctacgccgcctcatttttggacatggccgtg
cctctggcctttggccgccacgccgacgtgaccgcctacgccgtccttgacggcgtcctg
accgtcaccttcgccgacggccgtatgacgggtctggcccgcctcgaccagttcgccggc
tacgccggcccggccaaggccccaacggccgtggcgctggtcaaaaacggcctgcacatc
gaactgcgtttcgaccgctcccatcccgtgggcgcggccagcccttcgggcctcaaggac
gtggtcctggaatcggccctgaccaccatccttgactgcgaggattccgtggccgtggtg
gacggcccggacaaggcccaggcctaccgcaacctgctggggctattccggggcgagctg
gaagcgacctttgaaaagggcggcaagactttggcccgggccatggccgacgacaagacc
ttcaccgccccggacggcgggaagctcgtgctgcccggccgcagcctcatgcttgtgcga
aacgtggggcacctcatgaccaccgacgccgtgctggacgcggccggggaggagattccc
gaaggcttcctcgacgccctggccaccgccgccgtggctctgcacgaccagcgtgacctg
ggcaggaaacgcaattcccgccatggcagcgtctacatcgtcaaacccaagatgcacggc
cccgaggaagtcgcttttgcctgtgaaattttcgagcgggtggagcgggcgctttccatg
ccgccgcgcacgctcaaaatcgggatcatggacgaggagcggcgcacgtcgctcaatctc
aaggaatgtgtgcgcgccgccaaggaccgcatcattttcatcaacacgggctttttagac
cgcaccggcgacgagattcacacggtcatggaggccggaccggtggtcggcaagaacgcc
atgcgctcccaggcctggatggccgcctacgaggacggcaacgtggacgtgggccttagc
tgcggcttttccggcaaggggcagatcggcaagggcatgtgggccaaaccggaccgtatg
gccgagatggtggcggccaagatcgaccatcccaaggccggagccaactgcgcctgggtg
ccttcgcccacggcggctacgctccacgccatgcactaccacgccgtggacgtcttcgcc
cgccagcgcgaactggccgggcgcacgccggccaaccgcctcgatctgctcaaattgccg
gtgttgccggctggtgaagcgccttcccccgaggacaagaagcgggagatcgagaccaat
tgccaaagcatcctcggctacgtctcgcgctgggtggaccagggcatcggctgctccaag
gtcccggacctcgacgacgtgggcctcatggaagaccgggccacgctgcgcatctccagc
cagcatctggccaactggctgcgccatggtctgtgcacgcccgaggaggtggaggcgacg
ctggcgcgcatggccgccgtggtcgaccgccaaaacgccctggacccggcttaccggccc
atggccgccgacttggagaactccctggccttccaggccgcccgggagctgattttcgaa
gggatcaaccagccaaatggctacaccgaacccatcctcaccgcccgccgccgccaggcc
aaggcccggggctag

DBGET integrated database retrieval system