KEGG   Desulfovibrio magneticus: DMR_26970Help
Entry
DMR_26970         CDS       T00917                                 

Definition
hypothetical protein
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
dma  Desulfovibrio magneticus
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:dma01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:dma00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
3017870..3018667
Genome map
AA seq 265 aa AA seqDB search
MGVLRAGGPSAAGVCFGSRLGSTKTDAKIVQQGHQTPWGTFNKLKIKGKIFGTKSAFFLK
QTGKHCITRNTLPRSPHMNLTLTISGACCDLALHPVNAETAARVCMLGDNLYKTNSIEWW
RANSNNTCGMRLTADARIEAALDGASVAFDISRMSASAALLTQRPFLESPEKSLCLLGYD
DEACSRTWTWRNVTDYDMSRFEFFVQRWDAILGVADYLVIDDVCYDGRPADEAVWGESEG
FTFRTPLIVPASAARELAAAPRRAA
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgggggttctccgcgccggcgggccgagcgcggccggagtgtgcttcggaagccgtttg
gggtcaaccaaaacggacgcaaaaatcgtccaacagggtcaccaaaccccctggggaact
tttaacaaactaaaaataaaaggaaaaatattcggcacgaaaagtgctttttttctcaaa
caaacgggcaagcactgcatcacccgaaatactctcccaaggagtccccatatgaacctg
accctgaccatctccggcgcctgctgcgatctggcccttcatccggtgaacgccgaaacc
gccgcccgcgtctgcatgctcggcgacaacctctacaagaccaactccatcgagtggtgg
cgcgccaacagtaacaacacctgcggcatgcgcctgaccgccgatgcgcgcatcgaagcc
gccctggacggcgcttccgtggcctttgacatctcccgcatgagcgcgtccgccgccttg
ctcacccagcggcccttcctggagagtccggaaaagagcctgtgcctgctcggttacgac
gacgaggcctgctcgcgcacctggacctggcgcaacgtcaccgactacgacatgagccgc
ttcgaatttttcgtccagcgctgggacgccatcctcggcgtggccgactacctcgtcatc
gacgacgtctgctacgacggccggccggccgatgaagccgtctggggcgaaagcgaaggc
ttcaccttccgcacgccgctcatcgtgcccgccagcgccgcccgagaactcgccgcggcg
ccgcgacgcgccgcgtag

DBGET integrated database retrieval system