KEGG   Desulfovibrio magneticus: DMR_26970Help
Entry
DMR_26970         CDS       T00917                                 

Definition
hypothetical protein
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
dma  Desulfovibrio magneticus
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DMR_26970
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    DMR_26970
Enzymes [BR:dma01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     DMR_26970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
3017870..3018667
Genome map
AA seq 265 aa AA seqDB search
MGVLRAGGPSAAGVCFGSRLGSTKTDAKIVQQGHQTPWGTFNKLKIKGKIFGTKSAFFLK
QTGKHCITRNTLPRSPHMNLTLTISGACCDLALHPVNAETAARVCMLGDNLYKTNSIEWW
RANSNNTCGMRLTADARIEAALDGASVAFDISRMSASAALLTQRPFLESPEKSLCLLGYD
DEACSRTWTWRNVTDYDMSRFEFFVQRWDAILGVADYLVIDDVCYDGRPADEAVWGESEG
FTFRTPLIVPASAARELAAAPRRAA
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgggggttctccgcgccggcgggccgagcgcggccggagtgtgcttcggaagccgtttg
gggtcaaccaaaacggacgcaaaaatcgtccaacagggtcaccaaaccccctggggaact
tttaacaaactaaaaataaaaggaaaaatattcggcacgaaaagtgctttttttctcaaa
caaacgggcaagcactgcatcacccgaaatactctcccaaggagtccccatatgaacctg
accctgaccatctccggcgcctgctgcgatctggcccttcatccggtgaacgccgaaacc
gccgcccgcgtctgcatgctcggcgacaacctctacaagaccaactccatcgagtggtgg
cgcgccaacagtaacaacacctgcggcatgcgcctgaccgccgatgcgcgcatcgaagcc
gccctggacggcgcttccgtggcctttgacatctcccgcatgagcgcgtccgccgccttg
ctcacccagcggcccttcctggagagtccggaaaagagcctgtgcctgctcggttacgac
gacgaggcctgctcgcgcacctggacctggcgcaacgtcaccgactacgacatgagccgc
ttcgaatttttcgtccagcgctgggacgccatcctcggcgtggccgactacctcgtcatc
gacgacgtctgctacgacggccggccggccgatgaagccgtctggggcgaaagcgaaggc
ttcaccttccgcacgccgctcatcgtgcccgccagcgccgcccgagaactcgccgcggcg
ccgcgacgcgccgcgtag

DBGET integrated database retrieval system