KEGG   Desulfovibrio magneticus: DMR_26980Help
Entry
DMR_26980         CDS       T00917                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
dma  Desulfovibrio magneticus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dma00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    DMR_26980 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DMR_26980 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    DMR_26980 (thrC)
Enzymes [BR:dma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     DMR_26980 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(3019231..3020682)
Genome map
AA seq 483 aa AA seqDB search
MITTSDFPKYRGKMEYVCLGCQARFDIRELYYTCPHCGGVFLLEDTTFDSLLEYPASYWQ
GLFDKRASSRSTALRGVLRFYELMAPVMEEQDIVYLGEGHTPIVAANAALAELVGVPFAY
KNDGQNPSASFKDRGMACAFSYLKHLVRVNGWDSVLTVCASTGDTSAAAALYAAYVGGPI
KSVVILPKGKVTPQQLAQPLGSGATVIEVPGVFDDCMKVVEHLADNYRVALLNSKNAWRI
LGQESYAFEVAQWYGWDTYRKCVFVPIGNAGNVTAIMGGFLKLKKLGIIRSLPRIFGVQS
HHADPVFQYYDEADPAKREFRAVPVTPSAAQAAMIGNPVSFPRVAHFAKEYEKIGGPGSF
QVVQVTEQAIVEGMLLANRHGHISCTQGGECLAGLQKAKELGLIEASEEAILDATAHHLK
FIGFQEMYFEDSFPAAYGVKADPKYVNRPRSIMTDADKAALTPEDYTAKAASAIVESLGL
ARK
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgatcacgacgagcgattttcccaaataccggggcaagatggagtacgtctgcctgggc
tgccaggcccggttcgacatccgcgaactctactacacctgcccccattgcggcggcgtg
ttcctgctcgaagacaccaccttcgacagcctcctcgaatacccggccagctactggcag
gggcttttcgacaagcgcgcctcgtcgcgttccacggccctgcgcggcgtgctgcggttc
tacgaactcatggccccggtcatggaggaacaggacatcgtctacctgggcgagggccac
acgcccatcgttgccgccaacgccgccctggccgagctggtcggcgtgccgttcgcctat
aaaaacgacggccaaaaccccagcgcctccttcaaggaccggggcatggcctgcgcgttc
agctatttgaaacatctggtgcgggtcaatggctgggattcggtgctgaccgtgtgcgcc
tccaccggcgacacctcggccgccgccgcgctctacgccgcctatgtcggcggccccatc
aagtccgtggtcatcctgcccaagggcaaggtgaccccccagcagttggcccagcccctg
ggcagcggggccacggtcatcgaagtgcccggcgtctttgacgattgcatgaaggtcgtc
gagcatctggccgacaactaccgcgtggcgctgctcaattccaaaaacgcctggcgcatc
ctcggccaggaatcctacgccttcgaagtggcccagtggtacggctgggacacctaccgc
aaatgcgtgttcgtgcccatcggcaacgccggcaacgtcacggccatcatgggcggcttt
ttaaagctcaaaaagctcggcatcatccgctccctgccgcgcatcttcggtgtgcagtcc
caccacgccgacccggttttccagtattatgatgaggccgatccggccaagcgcgagttt
agggccgtgcccgtcacccccagcgccgcccaggcggccatgatcggcaacccggtttcg
tttccgcgcgtggcccatttcgccaaggaatacgaaaagatcggcggccccggcagcttc
caggtggtgcaggtcaccgagcaggccatcgtcgaaggcatgcttctggccaaccgccac
ggccacatcagctgcacccagggcggcgaatgcctggccggcctgcaaaaggccaaggag
cttgggctcatcgaagcctccgaagaagccatcctcgacgccaccgcccaccacctcaaa
ttcatcggcttccaggaaatgtacttcgaggacagcttccccgccgcctacggcgtcaag
gccgaccccaagtacgtcaaccggccgcgctccatcatgaccgacgccgacaaggcggcg
ctcactcccgaagactacaccgccaaggccgcctcggccattgtcgaaagcttgggcctg
gcgcgtaaatga

DBGET integrated database retrieval system