KEGG   Desulfovibrio magneticus: DMR_27100Help
Entry
DMR_27100         CDS       T00917                                 

Definition
phosphohexose mutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
dma  Desulfovibrio magneticus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dma00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:dma00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:dma00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:dma00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:dma00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:dma00520]
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:dma00230]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:dma00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
3031249..3032613
Genome map
AA seq 454 aa AA seqDB search
MKPITPAPFRAYDIRGIVDADFDEEWVERLGRALGTFFLRRGHSQAVVGHDCRLTSPGYQ
AQLAAGLASCGVDVVCLGMVPSPVFYYAVKALGRRAGAVVTASHNPSEFNGFKVWSGETT
IHTDDIREIYDIMAAGEFPSGTGIVCEHDIKPSYIEHVAEQMVLPRTVSVVVDGGNGAGG
LVCCDVLRQAGARVTPLYCEPDGRFPNHHPDPVIHKNIADLAARVVAEGADFGVGLDGDA
DRIGVVDNTGRLLYGDQLLAIYARAVLQNHPGATVIGEVKCSHLLYKDIAAHGGDPLMAA
TGHSLIKSKMRETGAILAGEMSGHMFFADRYYGFDDAIYAAARLAEIVAASSTPLSEMLA
DWPATVNTPEIRVDCPDAIKFAVVDKAKRHFTNGYDVIDVDGVRLTFPDGWGLLRASNTQ
PALVVRFEAENETRLDEIRRLIEEPVTAWIKELS
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccaatcacgcccgcgccgtttcgggcctatgacatcaggggaatcgtcgacgcc
gacttcgacgaggaatgggtggagcgccttggccgggcgcttggaacgtttttcctgcgc
cggggccacagccaggccgtggtcggccacgactgccgtctgacctcaccgggctaccag
gcccagttggccgccggactggcctcctgcggcgtggatgtggtctgcctgggcatggtc
ccaagcccggtcttctactacgccgtcaaggccctaggccgccgggccggcgcggtggtg
acggccagtcacaatccttcggaattcaacggattcaaggtctggtccggagaaaccacc
atccacaccgacgacatccgggaaatctacgacatcatggccgccggggaattcccttcg
ggcacgggcatcgtgtgcgaacacgacatcaagccgtcgtacatcgagcacgtggccgag
cagatggtgctgccccggaccgtctcggtggtggtggacggcggcaacggagccggcggc
ctcgtctgctgcgacgtgctgcgccaggccggagcccgggtcacgcccctttactgcgag
cccgacggccgctttcccaaccatcatcccgatcccgtcatccacaagaacatcgccgac
ctggccgcccgggtcgtggccgagggcgcggacttcggcgtgggccttgacggcgacgcc
gaccgcatcggcgtggtggacaacaccggccggctgctctacggcgaccagctcctggcc
atctacgcccgggccgtgctccaaaaccatcccggagccacggtcatcggcgaggtcaag
tgcagccacctgctctataaagacatcgccgcccacggcggcgatcccctcatggccgcc
accggccattcgctcatcaaatccaaaatgcgcgaaaccggggccatcctggccggcgag
atgagcggccacatgtttttcgccgaccgctactacggtttcgacgacgccatctacgcc
gccgcccggctggccgagatcgtggccgcctcgtccacgcccctgtccgagatgctggcc
gactggccggccacggtcaacacgccggaaatccgcgtcgattgccccgacgccatcaag
ttcgcggtggtggacaaggccaaacggcactttaccaatggttacgacgtcatcgacgtg
gacggcgtgcgcctgaccttcccggacggttggggactgcttcgcgcctccaacacccag
ccggccctggtggtgcgcttcgaagccgagaacgagacgcgcctggacgaaatccgccgt
ctcatcgaggaaccggtgacagcctggatcaaggagctttcctag

DBGET integrated database retrieval system