KEGG   Desulfovibrio magneticus: DMR_27730Help
Entry
DMR_27730         CDS       T00917                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
dma  Desulfovibrio magneticus
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:dma00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
3114144..3115637
Genome map
AA seq 497 aa AA seqDB search
MANYILSLDQGTTSSRAILFTREGDIKQIAQKEFTQIYPQPGWVEHNANEIFDTQSYVMR
ECLQFAGVDASDVAAIGITNQRETTVVWDKKTGAPIHNAIVWQDRRTAGFCDELKAKGLA
DVIRQKTGLVIDAYFSGTKVRWILDNVPGAREKADKGELLFGTIDSWLIWNLTKGAVHVT
DESNASRTLLFNINTGAWDDELLAIIGVPAAMLPRVSKSSEVVGEIHPEFLGKALPIAGN
AGDQQAATYGNACLKEGMAKNTYGTGCFMLMNTGKAPRPSNNNLLTTMAWATPSGRYFAL
EGSVFIAGAVVQWLRDGLGIIQSAPEVEQLALSVPDNGGVFLVPAFAGLGAPHWDQYARG
AMVGITRGATKAHIARAALESIALQTLDIMDCMQKDAGIKLDTLRADGGATRNNLLMQFQ
ADVLGVPVERPMVTETTALGAAYLAGLAVGFWKSEEEIAAMWQLDRRFEPNMAQSDRDKL
LHDWQRAVARSKAWIEA
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggccaattacattctctccctcgaccagggcaccaccagctcccgcgctatcctgttc
acccgcgaaggcgacatcaaacagatcgcccagaaagagttcacccagatctacccccag
ccgggctgggtcgagcacaacgccaacgagatcttcgacacccagtcctacgtcatgcgc
gaatgcctgcagttcgccggcgtggacgcctcggacgtggccgccatcggcatcaccaac
cagcgtgaaaccacggtcgtctgggacaagaaaaccggcgcacccatccacaacgccatc
gtctggcaggaccgccgcaccgccggcttctgcgacgaactcaaggccaagggcctggcc
gacgtcatccgccagaaaacgggcctcgtcatcgacgcctacttctccggcaccaaggtc
cgctggattctcgacaacgtgcccggcgcccgggaaaaggccgacaagggcgaactgctc
ttcggcaccatcgactcctggctcatctggaacctgaccaagggcgcggtccacgtcacc
gacgagtccaacgccagccgcaccctgctttttaacatcaacaccggagcctgggacgac
gagctgctggccatcatcggcgtgccagccgccatgctgccccgggtgtccaagtcctcg
gaagtggtgggcgaaatccaccccgaattcctgggcaaagccctgcccatcgccggcaac
gccggcgaccagcaggccgccacctacggcaacgcctgcctcaaggaaggcatggccaag
aacacctacggcaccggctgcttcatgctcatgaacaccggcaaggccccccgccccagc
aacaacaacctgctgaccaccatggcctgggccaccccgtccggccgctacttcgccctg
gaaggcagcgtctttatcgccggcgccgtggtccagtggctgcgcgacggcctgggcatc
atccaaagcgccccggaagtcgaacagctggccctgtccgtgcccgacaacggtggcgtc
ttcctcgtgccggccttcgccggcctgggcgcgccccactgggaccagtacgcccgcggg
gccatggtcggcatcacccgaggcgccaccaaggcccacatcgcccgggccgccctggag
tccattgccctgcagacccttgacatcatggactgcatgcaaaaagacgccggcatcaag
ctcgacaccctgcgcgccgatggcggggccacccgcaacaacctgctcatgcagttccag
gccgacgtgctgggcgtgcccgtcgagcgccccatggtgaccgaaaccacggccctgggc
gcggcctacctggccggcctggccgtcgggttctggaagagcgaagaagagatcgccgcc
atgtggcagctcgaccgccgctttgaacccaacatggcccagtccgaccgcgacaagctc
ctccacgactggcagcgcgccgtggcccgcagcaaggcctggatcgaagcctag

DBGET integrated database retrieval system