KEGG   Desulfovibrio magneticus: DMR_29420Help
Entry
DMR_29420         CDS       T00917                                 

Gene name
ispE
Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
dma  Desulfovibrio magneticus
Pathway
dma00900  Terpenoid backbone biosynthesis
dma01100  Metabolic pathways
dma01110  Biosynthesis of secondary metabolites
dma01130  Biosynthesis of antibiotics
Module
dma_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:dma00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DMR_29420 (ispE)
Enzymes [BR:dma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     DMR_29420 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: BAH76433
NITE: DMR_29420
UniProt: C4XHQ9
Position
3324258..3325148
Genome map
AA seq 296 aa AA seqDB search
MASFPCPIEETLLPVPCKVNLRLAVGARRPNGYHDIDTFFLPLPEPADVLRLRRFDGPGD
IDLQCSDPELETDDNLVVRAYRAYAAATGYAPRLEVHLAKHIPHGAGLGGGSSDAAVMLR
YLNDRADEAALSPVDLAALALTLGADIPFFLLGVPAVATGVGETLIPADPGLAGWCAVVV
CPEARVKTAWAYAALDASRALPQKPGANLLTTAFDANKRAFCVTGAPMRNDFESVVFAAH
PELGRVKERLLALGAAGALLSGTGSAVFGLFRKRQTATLALAMLTGSGPRAYLAPL
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggcgtctttcccctgccctatcgaggaaaccctcctgcccgtgccctgcaaggtcaat
ctgcgcctggccgtgggcgcgcggcggcccaacggctaccacgacatcgacacctttttc
ctgcccctgcccgaaccggccgacgtcctgcgtctgcgccgcttcgacggccccggggac
atcgatctgcaatgttccgatcccgagcttgaaaccgacgacaatctggtcgttcgggcc
taccgggcctacgctgcggccacgggctacgccccgcgtctggaagtccatctggccaag
cacattccccacggagccggccttggcggcggttcgtccgacgccgccgtcatgctgcgc
tatttgaacgaccgggccgatgaagccgccctgtcgcccgtggacctggccgccctggcc
ctgacccttggcgcggacatcccctttttcctgctcggcgtcccggccgtggccaccggc
gtgggcgagacgctcatcccggccgatcccggcctggccggctggtgcgccgtggtggtg
tgccccgaagcccgggtcaagaccgcctgggcctatgccgccctggacgcctcccgggcc
ttgccgcaaaaacctggggcaaacctcttgacaactgcttttgacgccaataaaagggcg
ttttgcgtcaccggtgcgcccatgcggaacgactttgaaagcgtcgttttcgcggcccac
cccgaactggggcgggtcaaggagcgcctgctggcccttggggcagcgggcgcgctttta
tcgggcacgggttcggcggtgttcgggcttttccgcaagcgccagacggccaccctggcc
ctggccatgctcaccggaagcggcccgcgtgcctatctcgcgccgctgtga

DBGET integrated database retrieval system