KEGG   Desulfovibrio magneticus: DMR_31320Help
Entry
DMR_31320         CDS       T00917                                 

Gene name
gpmA
Definition
(RefSeq) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
dma  Desulfovibrio magneticus
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DMR_31320 (gpmA)
   01230 Biosynthesis of amino acids
    DMR_31320 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DMR_31320 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    DMR_31320 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DMR_31320 (gpmA)
Enzymes [BR:dma01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     DMR_31320 (gpmA)
Exosome [BR:dma04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   DMR_31320 (gpmA)
  Exosomal proteins of melanoma cells
   DMR_31320 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
3547789..3548538
Genome map
AA seq 249 aa AA seqDB search
MHTLVLVRHGQSVWNLENRFTGWTDVGLTPQGREEAAQAANLLRDGGYDFDACLTSVLSR
AVMTLDILLTGLDRLWLPVTKSWRLNERHYGGLQGLNKAEMAAQYGEEQVFVWRRSYDTP
PPALDPADERFPGRDRRYATLTDAELPRCESLKDTVARVMPFWHDVMAPAIASGTRLLVA
AHGNSLRALVKYLDAIGDDAISECNIPTGVPLIYKLDASLKPLEHFYLGDAEAVARKAAA
VAAQGKAKG
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgcataccctggtcctcgtgcgccacggccaaagcgtgtggaacctcgaaaaccggttc
accggctggaccgacgtgggcctgacgccccagggccgggaggaagccgcccaggcggca
aacctccttcgcgacggcggctacgacttcgacgcctgcctgacctcggtgctctcccgg
gccgtcatgaccctcgacatcctcctgaccggcctcgaccgcctgtggctgccggtcacc
aaatcctggcgcttaaacgaacgccactacggcgggctccagggccttaacaaggccgaa
atggccgcccagtacggcgaggagcaggtgttcgtctggcgccgaagctacgacactccg
cccccggccctggaccccgccgacgaacgcttccccggccgcgaccggcgctatgcaacc
ctcaccgacgccgaactgccgcgctgcgaatcgctcaaggacaccgtggcccgggtcatg
cccttctggcacgacgtcatggccccggccatcgcctcgggcacgcggctgctcgtggcc
gcccacggcaactccctgcgcgccctggtcaaatacctcgacgccatcggcgacgacgcc
ataagcgaatgcaatatcccaacaggcgtgccgcttatctacaaactcgacgcctccctc
aaacccctcgaacacttctacctcggcgacgccgaagccgtggcccgcaaagccgccgcc
gtggccgcccagggcaaggcgaagggataa

DBGET integrated database retrieval system