KEGG   Desulfovibrio magneticus: DMR_31320Help
Entry
DMR_31320         CDS       T00917                                 

Gene name
gpmA
Definition
(GenBank) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
dma  Desulfovibrio magneticus
Pathway
dma00010  Glycolysis / Gluconeogenesis
dma00260  Glycine, serine and threonine metabolism
dma00680  Methane metabolism
dma01100  Metabolic pathways
dma01110  Biosynthesis of secondary metabolites
dma01120  Microbial metabolism in diverse environments
dma01130  Biosynthesis of antibiotics
dma01200  Carbon metabolism
dma01230  Biosynthesis of amino acids
Module
dma_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
dma_M00002  Glycolysis, core module involving three-carbon compounds
dma_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dma00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DMR_31320 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    DMR_31320 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DMR_31320 (gpmA)
Enzymes [BR:dma01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     DMR_31320 (gpmA)
Membrane trafficking [BR:dma04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    DMR_31320 (gpmA)
Exosome [BR:dma04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   DMR_31320 (gpmA)
  Exosomal proteins of melanoma cells
   DMR_31320 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 Ldr_toxin
Motif
Other DBs
NCBI-ProteinID: BAH76623
NITE: DMR_31320
UniProt: C4XIQ5
Position
3547789..3548538
Genome map
AA seq 249 aa AA seqDB search
MHTLVLVRHGQSVWNLENRFTGWTDVGLTPQGREEAAQAANLLRDGGYDFDACLTSVLSR
AVMTLDILLTGLDRLWLPVTKSWRLNERHYGGLQGLNKAEMAAQYGEEQVFVWRRSYDTP
PPALDPADERFPGRDRRYATLTDAELPRCESLKDTVARVMPFWHDVMAPAIASGTRLLVA
AHGNSLRALVKYLDAIGDDAISECNIPTGVPLIYKLDASLKPLEHFYLGDAEAVARKAAA
VAAQGKAKG
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgcataccctggtcctcgtgcgccacggccaaagcgtgtggaacctcgaaaaccggttc
accggctggaccgacgtgggcctgacgccccagggccgggaggaagccgcccaggcggca
aacctccttcgcgacggcggctacgacttcgacgcctgcctgacctcggtgctctcccgg
gccgtcatgaccctcgacatcctcctgaccggcctcgaccgcctgtggctgccggtcacc
aaatcctggcgcttaaacgaacgccactacggcgggctccagggccttaacaaggccgaa
atggccgcccagtacggcgaggagcaggtgttcgtctggcgccgaagctacgacactccg
cccccggccctggaccccgccgacgaacgcttccccggccgcgaccggcgctatgcaacc
ctcaccgacgccgaactgccgcgctgcgaatcgctcaaggacaccgtggcccgggtcatg
cccttctggcacgacgtcatggccccggccatcgcctcgggcacgcggctgctcgtggcc
gcccacggcaactccctgcgcgccctggtcaaatacctcgacgccatcggcgacgacgcc
ataagcgaatgcaatatcccaacaggcgtgccgcttatctacaaactcgacgcctccctc
aaacccctcgaacacttctacctcggcgacgccgaagccgtggcccgcaaagccgccgcc
gtggccgcccagggcaaggcgaagggataa

DBGET integrated database retrieval system