KEGG   Desulfovibrio magneticus: DMR_33480Help
Entry
DMR_33480         CDS       T00917                                 

Gene name
cheB
Definition
chemotaxis response regulator protein-glutamate methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
dma  Desulfovibrio magneticus
Pathway
Two-component system
Bacterial chemotaxis
Module
CheA-CheYBV (chemotaxis) two-component regulatory system
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:dma02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:dma02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(3759169..3760272)
Genome map
AA seq 367 aa AA seqDB search
MIKVVVIDDSAFMRKALAAMLSKDPEIEVVGAARDGEEGLEMIRRHQPDVVTLDIEMPRM
DGLTALRHIMMEMPRPVLMVSSLTTEGAEATLKAMELGAVDFIPKQLSKVSLDIVKIEDD
LRAKVKLIAKRRMSHLSRSSLTARVRAAGAAGAAQAGAAPAAPVERPSRATRPGGAQTRD
LVAIGVSTGGPPAVQKVLSVLPKDFPAGILIAQHMPAAFTGPFAKRLDSVCQITVKEAED
GERLQHGVAYVAPGGKHLRLDQKVSRIDVRVVEEPREALYKPSATVLFESVAAGVGRRGL
GVVLTGMGSDGLDGMKVLKAKGGRALAQSDSTCVVYGMPKAIVDAGLADEIVDIDDMGEA
ILQNLYK
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
gtgatcaaggtagtggtcatcgacgattcggctttcatgcgcaaggcgctggccgccatg
ctgtccaaggaccccgagatcgaggtcgtgggcgcggcccgcgacggcgaggaaggcctg
gaaatgatccgtcggcatcagcccgacgtggtcaccctggatattgaaatgccccgcatg
gacggactgaccgccctgcgccatattatgatggaaatgccccggcccgtgctcatggtg
agttccctgaccaccgagggcgccgaggccacgctcaaggccatggagcttggggccgtg
gatttcattcccaagcagctgtccaaggtgtcgctggacatcgtcaagatcgaggacgat
ttgcgggccaaggtcaagctcatcgccaagcggcgcatgagccatttgtcccgttcgtcc
ctgaccgcccgggtgcgggccgccggcgcggcgggcgcggctcaggcgggagcggccccg
gcggccccggtcgaacggccgtcccgggcgacccggcccggcggcgcccagacccgcgat
ctggtggccatcggcgtgtccacgggcgggccgccggcggtgcagaaggtgctgtcggtg
ttgcccaaggattttccggccggcattttgatcgcccagcacatgccggccgcctttacc
ggcccctttgccaagcgtctggacagcgtgtgccagatcacggtcaaggaagccgaggac
ggcgaacgcctccagcacggcgtggcctacgtggccccgggcggcaagcacctgcgcctg
gaccagaaggtgagccgcatcgacgtgcgggtggtggaagagccgcgcgaggccctgtac
aaaccttcggccacggtgctctttgagtccgtggcggccggggtcggccgacgcgggctg
ggagtggtcctgaccggcatggggtccgacggcctggacggcatgaaggtgctcaaggcc
aagggcggccgcgccctggcccagtccgactccacctgcgtggtctacgggatgcccaag
gccattgtcgacgcggggttggccgacgagatcgtggacatcgacgacatgggcgaagcg
atcctgcaaaacctttacaaatga

DBGET integrated database retrieval system