KEGG   Desulfovibrio magneticus: DMR_33480Help
Entry
DMR_33480         CDS       T00917                                 

Gene name
cheB
Definition
(GenBank) chemotaxis response regulator protein-glutamate methylesterase
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
dma  Desulfovibrio magneticus
Pathway
dma02020  Two-component system
dma02030  Bacterial chemotaxis
Module
dma_M00506  CheA-CheYBV (chemotaxis) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:dma00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    DMR_33480 (cheB)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    DMR_33480 (cheB)
Enzymes [BR:dma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     DMR_33480 (cheB)
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     DMR_33480 (cheB)
Two-component system [BR:dma02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   DMR_33480 (cheB)
Bacterial motility proteins [BR:dma02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    DMR_33480 (cheB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest Response_reg B12-binding
Motif
Other DBs
NCBI-ProteinID: BAH76839
NITE: DMR_33480
UniProt: C4XK99
Position
complement(3759169..3760272)
Genome map
AA seq 367 aa AA seqDB search
MIKVVVIDDSAFMRKALAAMLSKDPEIEVVGAARDGEEGLEMIRRHQPDVVTLDIEMPRM
DGLTALRHIMMEMPRPVLMVSSLTTEGAEATLKAMELGAVDFIPKQLSKVSLDIVKIEDD
LRAKVKLIAKRRMSHLSRSSLTARVRAAGAAGAAQAGAAPAAPVERPSRATRPGGAQTRD
LVAIGVSTGGPPAVQKVLSVLPKDFPAGILIAQHMPAAFTGPFAKRLDSVCQITVKEAED
GERLQHGVAYVAPGGKHLRLDQKVSRIDVRVVEEPREALYKPSATVLFESVAAGVGRRGL
GVVLTGMGSDGLDGMKVLKAKGGRALAQSDSTCVVYGMPKAIVDAGLADEIVDIDDMGEA
ILQNLYK
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
gtgatcaaggtagtggtcatcgacgattcggctttcatgcgcaaggcgctggccgccatg
ctgtccaaggaccccgagatcgaggtcgtgggcgcggcccgcgacggcgaggaaggcctg
gaaatgatccgtcggcatcagcccgacgtggtcaccctggatattgaaatgccccgcatg
gacggactgaccgccctgcgccatattatgatggaaatgccccggcccgtgctcatggtg
agttccctgaccaccgagggcgccgaggccacgctcaaggccatggagcttggggccgtg
gatttcattcccaagcagctgtccaaggtgtcgctggacatcgtcaagatcgaggacgat
ttgcgggccaaggtcaagctcatcgccaagcggcgcatgagccatttgtcccgttcgtcc
ctgaccgcccgggtgcgggccgccggcgcggcgggcgcggctcaggcgggagcggccccg
gcggccccggtcgaacggccgtcccgggcgacccggcccggcggcgcccagacccgcgat
ctggtggccatcggcgtgtccacgggcgggccgccggcggtgcagaaggtgctgtcggtg
ttgcccaaggattttccggccggcattttgatcgcccagcacatgccggccgcctttacc
ggcccctttgccaagcgtctggacagcgtgtgccagatcacggtcaaggaagccgaggac
ggcgaacgcctccagcacggcgtggcctacgtggccccgggcggcaagcacctgcgcctg
gaccagaaggtgagccgcatcgacgtgcgggtggtggaagagccgcgcgaggccctgtac
aaaccttcggccacggtgctctttgagtccgtggcggccggggtcggccgacgcgggctg
ggagtggtcctgaccggcatggggtccgacggcctggacggcatgaaggtgctcaaggcc
aagggcggccgcgccctggcccagtccgactccacctgcgtggtctacgggatgcccaag
gccattgtcgacgcggggttggccgacgagatcgtggacatcgacgacatgggcgaagcg
atcctgcaaaacctttacaaatga

DBGET integrated database retrieval system