KEGG   Desulfovibrio magneticus: DMR_36600Help
Entry
DMR_36600         CDS       T00917                                 

Definition
chemotaxis CheB/CheR fusion protein
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
dma  Desulfovibrio magneticus
Pathway
Two-component system
Bacterial chemotaxis
Module
CheA-CheYBV (chemotaxis) two-component regulatory system
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:dma02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:dma02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
4143009..4147559
Genome map
AA seq 1516 aa AA seqDB search
MPTPSKDSTLNDNNATNTINHPGGPPERKQKNEITDNLHIVGVGASAGGLEALEFFFNQM
PPKNGLAFVVIQHLSPDFKSLMDEILSRQTSMAIHRVEDGMELLPDSIYLIPPKKEMTVR
KGKLFLFDKEPSRPLEMPIDIFFRSMAKESGERAIGVILSGTGSDGSRGIGAIHEAGGLV
LVQSPDTAQFDGMPRSAIDTGMVNFILSPKEMPEVILQYLNDPQAFRRSEQQTLLDGQAI
DDESSMALALLKRHYGIDFAYYKPTTVGRRLSRRMTMRQMSRLSDYLDFLSTNVEELNDL
YKDLLIGVTSFFRDPEAFSKMEREIIPSIFESASENEEIRAWIAGCATGEEVYSLGILLY
EEARRRQFKKKITIFATDVHRESLEFASQGLYDLNRFSGMSPERKSRFFREENGLRYRVC
PELRSMVVFAPHNVISDPPFTKMDLVSCRNMLIYLLPVAQEKAISLFHFALKVGGILFMG
SSESPGALAPEFDVIDSKNKIFKKMRDVKLNLDLRLSSPGEKFKRGNVPVTSTAGMDRNL
LRDYDLLLKKYMPTGLIVGERREVLHFFGDVSRYLTNIAGRAERDVIDMVEGDLKLALGA
ALHRAASENTRIVFKHVKIAMQGGHELVDLAVECLTDDKLTQRHYHVTFLPPSSITVSAI
ENEKCGTETAFLPTDEVWRRIAELEGDLQTTRENLQATIEELQTTNEELQATNEEMLAAN
EELQSTNEELHSVNEELYTVNAEFEKKNKELRELNEDHDNLLRSTEVGTLFLDDKLCIRK
FNPAITKSFKLLPHDVGRPVDHIAYQFSGQAEMLQDLRDVLSTGNMIEREIQANDEEWLL
QRVLPFKSDSGIKGVVLTFTDISKIKAFELERNKAKLLKELASSVPGMVFQYASSPVGTS
GFTFISDGASSLLGSELASELITASRMSCMVYEADLVNFDQALIEATNSNSILDCEHRVK
SEGDNEKWLHTRCTPKTLHDGTVFWNGVSVDITERKIAAAQVSKAAEFYLTILNRAPALI
WRAGLDAKCDWFNATWLSFTGRDISQELGDGWADGVHPEDLQHCLDTYKKSFIARQFFEM
EYRMRRHDGEYRWIVDFGCPFKNINGEFGGYIGFCYDITDRRQATLDLELARFNAEEANR
TKSEFLANMSHEIRTPLNGVLGMLQLLQSTSLDVEQKEYSIAAVDSCIRLTRLLSDILDL
SRVEAGKLGIQAVPFDLSETVNVVNELFKTQAIESGITLDFHIDQDIPKRLIGDAPRLQQ
VLCNLVGNALKFTHAGKIAVSSHLLPSSDPKRISLMFSISDTGIGIPHDKIDLLFTPFTQ
VSEGYTRRHQGAGLGLSICKHLVTLMGGNISISSVLGQGTTVNFSANFDFNEYCPIDNSP
DLTRSQNLKMTFNILLAEDDNVNRLVAQRMLEKAGCTITLVENGRQAIEALRVGSFDAIL
MDVQMPVMDGVAATTAIRNGEAGKEHTRIPIIAMTAYTMSGDREKFLASGMDGYISKPLE
ISNLLEVLKRALDPVS
NT seq 4551 nt NT seq  +upstreamnt  +downstreamnt
atgccaactccttcaaaagattccacactaaacgataacaatgcaactaacacgataaat
catcctggcggaccccctgagcgtaagcaaaaaaatgaaataactgacaatttacatatt
gttggagttggagcttctgcaggtgggctagaagcacttgagttttttttcaatcaaatg
ccgcctaagaatggtcttgcattcgttgttattcagcatctttctcctgattttaaaagt
ctaatggatgaaatattatcgaggcagacgtcgatggcgatacatcgtgtcgaagatgga
atggaacttcttcctgacagtatatacttaattccgcctaaaaaagaaatgacagtcaga
aaaggtaaactctttctcttcgacaaggagccttcacgccctttagaaatgcctatcgat
attttttttcgctctatggcgaaagaatctggagagagagcaattggagtaattttatca
ggcacaggatctgatggttctcgtggcataggagctattcacgaagctggaggtcttgtt
ttggttcagtctcctgatactgctcaattcgatggaatgccacgaagtgcaatagacaca
ggaatggttaattttattttgtcgcctaaagaaatgcctgaagtaattttacagtattta
aatgatccacaagcatttaggcggtctgagcagcagactttacttgatggccaagcaatt
gatgatgaaagttctatggcgttagctctgttgaaaaggcattatgggatagattttgcg
tattacaagccaaccacagtgggccgccgcctctcccgtcggatgactatgcgtcaaatg
tccaggctgtccgattacttagactttttaagcactaacgtggaagaactgaatgattta
tataaagaccttcttattggagtgaccagtttctttagagatccagaagctttcagcaaa
atggaacgagaaataattccttccatattcgaatcagctagtgagaatgaagagattaga
gcatggatcgcaggctgcgcaacaggtgaagaagtctattcattgggaatcctgctttat
gaagaagcccgtcgtcggcagtttaaaaagaaaatcaccatttttgcaacggacgttcac
cgtgaatctttagaatttgcctcacaaggtttgtacgatctaaataggtttagtggaatg
tcgccagaacgtaagtctcgtttttttcgagaagaaaacggtttgcgctatcgtgtctgt
cctgaattacgatcaatggttgtgtttgctcctcacaacgtaataagcgatccgcctttc
acgaaaatggatttagtatcttgtcgaaatatgctgatttaccttctcccagttgcacaa
gaaaaagcaatttccttgtttcattttgctcttaaggtgggtggcattttattcatggga
tcaagcgaaagtcctggtgcgcttgcaccagaatttgatgttatcgactccaaaaataaa
atttttaaaaagatgagagatgttaagctcaatctagatttgcggctttcttcaccagga
gaaaaatttaaaagagggaatgtccctgtaacgtcaacagctggtatggatcgaaactta
ctccgtgactatgacctgttactcaaaaaatatatgccaacgggattgatcgttggcgag
cgccgcgaggttctacatttttttggtgatgtctctcggtatttgacaaatattgctggg
cgggctgaacgagacgttattgacatggttgagggcgatttgaaactagctcttggtgca
gctttacaccgagctgcatcagaaaatacgcgcatcgtattcaaacatgtcaagattgcg
atgcagggtgggcatgagcttgttgacctagctgtagagtgcttgactgatgataaattg
actcagagacattaccatgtaacttttttgcctcccagttctatcacagtgtcagcgatt
gaaaatgaaaaatgtggcactgaaacagccttccttccaaccgatgaagtttggagacgt
attgctgaactagaaggagatcttcagaccactagagaaaatcttcaggcaaccattgaa
gagcttcaaacaacaaatgaagagcttcaagctacaaacgaagaaatgctagctgccaat
gaagaacttcagagcacgaacgaggagcttcattccgtcaacgaagaattatacacagta
aatgctgagtttgaaaaaaagaataaagagcttagagaactaaacgaggatcatgacaat
ttattgcgaagtactgaggtcggcacacttttccttgatgacaagctatgcattagaaaa
tttaatccagcaataacaaagtcatttaaattattgccccatgacgtcggtaggcctgtc
gaccacattgcataccaattttccggtcaggcagaaatgctacaagatcttcgagacgta
ttgtcaactggcaatatgattgagcgtgaaattcaagcaaatgacgaagagtggctgctt
caacgcgttcttccgtttaaaagcgactccgggattaaaggggtggttttgacatttaca
gacatttcaaaaataaaagcttttgaattagaaagaaataaggctaaattgttaaaagaa
cttgcttctagtgttccggggatggtttttcaatatgcctcatctcctgttggaacttcg
gggtttacttttataagtgatggtgcatcaagcctgcttggatccgagttggcgtcggaa
ttgataaccgccagtaggatgtcatgtatggtttacgaggcagatttagtcaattttgac
caagccttgattgaagcaactaatagtaatagtattcttgactgtgagcaccgagttaaa
tctgaaggtgataacgaaaaatggcttcatacccgctgcaccccaaaaactctgcatgat
ggtacagttttttggaacggtgtttcagtggatatcactgaaagaaaaattgctgctgcc
caagtttcaaaagctgctgaattttatttaactattttaaatagagcgcctgcgctcatc
tggcgtgcggggcttgatgccaaatgcgattggtttaatgctacatggctttcatttact
ggtcgagatattagtcaagaattgggtgacggttgggctgacggtgttcatcctgaagat
cttcagcattgcttagatacgtataaaaaatcatttattgccagacaattttttgaaatg
gaatatagaatgcgtcgtcacgacggtgaataccgttggattgtagattttggatgccca
tttaaaaatattaatggtgaatttggtggatacatcggtttttgttatgacataacagat
cgacgtcaagcaacattagacttagaactggcgagatttaatgccgaagaggcgaatagg
acaaaaagtgaatttttggccaatatgagccatgaaataaggacaccgttaaacggtgtc
cttggcatgctccaactgttgcaaagcacttctcttgatgttgagcaaaaagaatactcg
attgcagctgttgattcatgcattagattgactcgcttgctgtccgatattttagacctt
tcaagggtcgaagcaggaaagcttggcatccaggccgtcccttttgatctaagtgaaacc
gttaatgtcgttaatgaattatttaaaacccaagcaatcgagtctggcatcacattggat
ttccatattgaccaagacatccccaaaaggcttattggcgacgctcctcgcttgcagcaa
gtgctttgtaatttagtaggcaatgctcttaaatttactcacgcaggaaagatagctgtc
agtagtcatttgttgccgtcatcagatcctaaacgtataagtctaatgttttctatttcg
gacacaggcatcgggataccacatgacaagattgacttgctgtttaccccttttacgcaa
gtcagtgaaggatatactcggcgtcatcagggtgcaggacttgggctttcgatatgtaag
catcttgtaacattaatgggggggaacatctcaatatccagtgtcttggggcaaggcaca
acggtaaatttttctgcaaattttgattttaatgagtattgccctatagataattcgcct
gatctgacgcgctctcaaaatttaaaaatgacttttaacatccttttggcagaagatgat
aatgtgaatagattagtcgcgcaacggatgctagaaaaagctggatgtacaattactttg
gtggaaaatggaagacaagcaattgaagctttgcgcgttgggagctttgacgcaattctt
atggatgtacagatgccagtgatggatggggttgctgcaaccacagctattcgcaacgga
gaagcaggcaaagaacatactagaataccaattatagccatgacagcctatactatgtct
ggtgatagggaaaagtttttagcttcaggaatggatggctatatttcaaagccgttagag
atttctaacctgcttgaggtacttaagcgagctttggatcctgtttcttga

DBGET integrated database retrieval system