KEGG   Desulfovibrio magneticus: DMR_43130Help
Entry
DMR_43130         CDS       T00917                                 

Gene name
glgB
Definition
1,4-alpha-glucan branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
dma  Desulfovibrio magneticus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dma00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    DMR_43130 (glgB)
Enzymes [BR:dma01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     DMR_43130 (glgB)
Exosome [BR:dma04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DMR_43130 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
4874461..4876383
Genome map
AA seq 640 aa AA seqDB search
MRENSPIRHDVSRLTEEDIYLFKQGNHFDLPDKLGSAMMEVEGEPGVHFAVWAPNARTVS
VIGDFNDWDPDSHPMAVRHDASGVHECFIPGVPKGTRYKYHINSQIGGYKADKADPFAFY
WETSPHTASIVWDLDYQWNDAAWMENRRDKNGFASPISIYELHLGSFRRVHQDRYRSLSY
RELADHLTDHVLRAGFTHVEFLPVMEHPFFGSWGYQTLGYFAPTSRYGTPQDFMALIDRL
HQNGVGVVLDWVPSHFPADGHGLSYFDGTHLYEHADPRRGYHPDWNCYIFNTGRYEVRAF
LISSALFWLGRYHADALRVDAVASMLYLDYSRRDGEWIPNIHGGRENLDNIDFLRRLNEM
TYARFPDTETIAEESTSWPMVSRPPYLGGLGFGMKWNMGWMHDVLRYFSRDPIFRKYHHG
ELTFGIWYAFTENFVLALSHDEVVYGKGSLIRKMPGDDWRRFANLRLLYGFMFGHPGKKL
LFMGGEFAQWQEWNHDAELQWELLDSPPHQGVLQWVADLNAVYRSEPALHQRDFKAEGFE
WVDFRDAEASVLAFLRRGKDPDDMVLVVLNFTPVPREFYRVGVPRPGMWRELLNSDARPY
GGSGLGNAGAVMAEAVESFDRPYSLTLTLPPLGAVFLRPA
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgcgggagaatagccccatacgccacgacgtttcacgcctgaccgaggaagacatctat
ctcttcaaacagggcaaccacttcgatctgcccgacaagctcggttcggccatgatggag
gtcgagggcgaacccggcgtccacttcgccgtctgggctcccaacgcccgcaccgtctcg
gtcatcggcgacttcaacgactgggaccccgacagccaccccatggccgtgcgccacgac
gcctcgggcgtccacgaatgcttcatccccggcgtgcccaagggcacgcgctacaaatac
cacatcaactcccagatcggcggctacaaggccgacaaggccgatcccttcgccttttac
tgggagacctcgccccataccgcctccatcgtctgggacctcgactaccagtggaacgac
gccgcctggatggaaaaccgccgtgacaaaaacggctttgcctcgcccatctccatctac
gaactgcacctgggctcgtttcgccgcgtccaccaggaccgctaccgttccctgtcctac
cgggaactggccgaccacctgaccgaccacgtgctgcgggccggattcacccacgtggag
ttcctgccggtcatggaacaccccttcttcggctcctggggctatcagaccctgggctac
ttcgcccccaccagccgctacggcacgccccaagacttcatggcccttattgaccggctc
caccaaaacggcgtcggcgtggtgctggactgggtgccctcccatttcccggccgacggc
cacggcctgtcctatttcgacggcacccacctttacgagcacgccgatccgcgccggggc
taccacccggactggaactgctacattttcaacaccggccgctacgaagtgcgcgccttt
ctcatctccagcgcgcttttctggctgggccgctaccatgccgacgccctgcgcgtggac
gccgtggcctccatgctctacctcgactactcccgccgcgacggcgaatggattcccaac
atccacggcggccgggaaaacctcgacaacatcgactttttgcgccgcctcaatgaaatg
acctacgcccgcttcccggacaccgagaccattgccgaggaatccacatcctggcccatg
gtctcgcgcccgccctacctcggcggcctggggttcggcatgaagtggaacatgggctgg
atgcacgacgtgttgcgctacttttcccgcgacccgatcttccgcaaataccaccatggc
gaactcaccttcggcatctggtacgcctttaccgaaaatttcgtcctggccctgtcccac
gacgaggtcgtctacggcaaaggcagcctcatccgcaaaatgcccggcgacgactggcgg
cgtttcgccaacctgcgcctgctctacggcttcatgttcggccatccgggcaagaagctg
ctgttcatgggcggcgaattcgcccagtggcaggaatggaaccacgacgccgagctgcaa
tgggagctgctcgactcgccgccgcaccagggcgtgctgcaatgggtggccgacttaaac
gccgtctaccggtccgaaccggccctgcatcagcgcgatttcaaggccgaaggcttcgaa
tgggtcgatttccgcgacgccgaagccagcgtgctggcctttttgcggcgcggcaaggac
ccggacgacatggtgctggtggtgctcaacttcacgcccgtgccgcgcgagttctaccgg
gtcggcgtgcccaggcccggcatgtggcgggagctgctcaacagcgacgcccgcccctac
ggcggctcgggcctgggcaacgccggcgcggtcatggccgaagccgtcgagagctttgac
cgcccctattccctgacgctgaccctgccgccccttggcgccgtgttcttgcggccggcc
taa

DBGET integrated database retrieval system