KEGG   Desulfovibrio magneticus: DMR_43140Help
Entry
DMR_43140         CDS       T00917                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
dma  Desulfovibrio magneticus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dma00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    DMR_43140 (malQ)
Enzymes [BR:dma01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     DMR_43140 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
4876688..4878193
Genome map
AA seq 501 aa AA seqDB search
MLRRASGVLMHVTSLPSRFGIGDFGPGARRFARFLRQASQSYWQILPLSPTSTFIGNSPY
SSDSAFAVSPLLISPEAMVEDGWLDAATLEAAVVEGDPAVADFEQAQAKKEALFRAAFAA
GRQRLAGDAAYVVFCREAAGWLDDYALFRAAKREQHEAGFASWPAGLRDREPAALDALKI
RMADEIEYARFVQYLAHSQWTALRAQLRQADIQVIGDMPIYVTEDSADVWANPELFKLGP
DKRPVWVAGVPPDYFSKTGQRWGNPVYDWPAHEAEGFAWWLRRMERTLALYDIVRLDHFR
GFEAYWEIAASEATAINGTWVKAPGQALFTTLTRRFPALPIIAEDLGVITAEVRELMAAF
NFPGMRVLQFAFGPGIAENRDAPHNYEHNHVAYTGTHDNNTTLGWARGESGGEALESLYA
YLGRRVPHEEVPWELLRLIMQSAASKVIAPMQDILCLGEGARMNMPSVAKGNWSWRAVDN
HFDAAIAARLRGMTEIFGRNH
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgcagagccagcggcgtgctcatgcacgtcacctcgcttccctcccggttcggc
atcggcgatttcggccccggcgcgcggcgcttcgcccggtttctgcgccaggcttcccag
tcctattggcagatcctgcccctgtcgccgacgtcgacctttatcggcaactcgccctac
agcagcgattcggcctttgccgtgagtccgttgctcattagccccgaggccatggtcgag
gacggctggctggacgcggcaaccctggaggcggccgtggtggaaggcgatccggccgtg
gcggatttcgagcaggcgcaggccaagaaagaggcgctttttcgggcagcctttgccgct
ggccgccagcgactggccggcgacgccgcctatgtcgtcttttgccgcgaggcggccggc
tggctggacgattacgccctattccgggcggccaagcgcgaacagcacgaggccggcttc
gcctcgtggccggccgggctgcgcgaccgcgagccggcggccctggatgcgctgaaaatc
cgcatggccgacgagatcgaatacgcccggttcgtgcagtacctggcccacagccagtgg
acggccctgcgggcgcagctgcggcaggccgacatccaggtcatcggcgacatgcccatc
tacgtcaccgaggacagcgccgacgtctgggccaacccggagctgttcaagctcggcccg
gacaagcggccggtctgggtggccggggtgccgccggactatttcagcaaaaccggccag
cgctggggcaatccggtctacgactggccggcccacgaggccgagggttttgcctggtgg
ctgcggcgcatggaacggacgctggccctctacgacatcgtgcgcctggaccatttccgg
ggctttgaggcctactgggaaatcgcggccagcgaagcaacagccataaacggcacctgg
gtcaaggccccgggccaggcgcttttcaccacgctgacgcgccgcttcccggccctgccc
atcatcgccgaggatttgggcgtgattaccgccgaagtgcgcgaactcatggccgccttc
aacttccccggcatgcgcgtgctccagttcgccttcggcccgggcatcgccgaaaaccgc
gacgcgccccacaactacgaacacaaccatgtggcctacaccggcacccacgacaacaac
acgaccctcggctgggcgcgcggcgaatccggcggcgaggccctggaatcgctctacgcc
tacctcggccggcgcgtgcctcatgaggaggtgccctgggaactgctgcgcctgatcatg
caaagcgccgcctccaaggtcatcgcgcccatgcaggatatcctgtgcctgggcgaaggc
gcgcgcatgaacatgccgtctgtggccaagggcaactggtcctggcgggccgtggacaac
cacttcgacgcggccattgccgcgcggttgagggggatgaccgagatattcggccggaat
cattga

DBGET integrated database retrieval system