KEGG   Dehalococcoides mccartyi BTF08: btf_1160Help
Entry
btf_1160          CDS       T02475                                 

Gene name
proB
Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
dmc  Dehalococcoides mccartyi BTF08
Pathway
dmc00330  Arginine and proline metabolism
dmc00332  Carbapenem biosynthesis
dmc01100  Metabolic pathways
dmc01130  Biosynthesis of antibiotics
dmc01230  Biosynthesis of amino acids
Module
dmc_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:dmc00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    btf_1160 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    btf_1160 (proB)
Enzymes [BR:dmc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     btf_1160 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA Lon_2
Motif
Other DBs
NCBI-ProteinID: AGG08236
Position
1075486..1076607
Genome map
AA seq 373 aa AA seqDB search
MNENCYKRVVIKLGTSLLTGGTGKLDHERMADLCRQIAELTRLGTEIVIVSSGAIAAGRS
KMGIRHIPKDVPFKQVLAAIGQSQLMNYYDQLFSPHGLTVAQGLLTKSDLSDRSGYLNAR
NTLLALMELGIITIVNENDVVAIDEIQQAKFGDNDNLSAMVANLIEADLLLILTNIRGLY
TSDPTLHPEATLITEVKEITEELEQLAAGSSNKLGTGGMVTKLEAARLATSSGVTAIIAD
GHIPDIILKLANGENEGTRFIPSLHKPDSRQRWMMSGLCTRGSICVDDGAAKALRENQKS
LLAAGVQQAEGKFGRGDIVKLTDSHGKRLGYGITNYSSDDISKIKGLHSQELNAVLGGNQ
GPEVIHRNNLVVI
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaaaattgttataaacgggttgtaataaagttgggcaccagtctgctcaccggc
ggcacaggcaagcttgaccatgagcgcatggctgacctgtgccgacagatagccgaactg
acccgcctgggtactgagatagttatagtttcttcgggggctattgccgccggacgctct
aaaatgggtatccgccacattccgaaagatgttccttttaaacaagtgctggccgccata
ggccagagccagcttatgaattattatgaccagttattcagtcctcacgggctgacggtt
gcccaaggtctgctgaccaaaagtgacctgtctgaccgttcgggttacctcaacgcccga
aataccctgctggctttgatggaactgggaattataaccattgtcaatgaaaatgacgtg
gtagcaatagatgaaatccagcaagccaaatttggggataatgacaatctgtcggccatg
gtagccaacctgatagaggctgatttactgctgatactgaccaatatccgcgggctttac
acctcagaccctactctccaccctgaagctaccttgataaccgaggtcaaagagattacc
gaagaactggagcaactggccgccggcagctcaaacaagctgggtacaggcggaatggta
accaaactggaagccgccagactggccacatcttcaggggtaaccgccattattgcagac
gggcatataccggatattattctcaaactggcgaatggtgaaaatgaaggtacccgtttt
ataccttcactgcacaagccggatagccgccagcgctggatgatgagcgggctttgcacc
cgcggcagcatctgtgtagatgacggggcagccaaagcactaagagaaaaccagaaaagc
ctgctggccgccggggtgcaacaggccgaaggcaaattcgggcggggtgatattgtaaag
cttaccgacagccacggaaaacggctgggttatggcataaccaattactcttcagatgat
atttccaaaataaaaggccttcactcacaggaactaaacgccgttttagggggcaaccaa
ggccctgaagtaatacaccgcaataatctggtggtaatttaa

DBGET integrated database retrieval system