KEGG   Dehalococcoides mccartyi BTF08: btf_1581Help
Entry
btf_1581          CDS       T02475                                 

Definition
class II aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
dmc  Dehalococcoides mccartyi BTF08
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dmc00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    btf_1581
Enzymes [BR:dmc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     btf_1581
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1450787..1451368
Genome map
AA seq 193 aa AA seqDB search
MNGQTPSETLHWFIQAGKLLFGRGLVSSHSGNLSQRWKDKLYITRTGSSLPLFSETDLIL
TGLDHNDQFTPLASSELPVHRAIYRRTSAKAIVHAHPPYAAALSLLEGEIIPDCGEGLYC
LGAIPVIGFGERVHPGSLAEAVATALETHRVIVVAGHGSFATGENIEEALKYTFALEEMC
QVTYLARILKKAD
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
ttgaacggtcaaacaccttctgaaaccctgcattggtttatacaggctggaaaactgctt
ttcgggcggggactggtttcctcacactccggcaacctcagccaacgatggaaagacaag
ctttacataacccgaaccggcagttcactgcctctttttagcgaaacagacctgatactg
accggtcttgaccataatgaccagtttaccccgcttgcctcaagcgaactgcccgttcac
cgggctatttaccgccgcacatccgccaaagccatagttcatgctcacccgccttatgcg
gccgctctctccctgcttgagggggaaataataccggactgcggtgaggggctttactgc
ctgggagctataccggttatcggtttcggagagcgggttcatcccggcagtctggcagaa
gcagtggctacagcactggaaacacaccgggttatagtggtagccggtcatggcagcttt
gcaacaggggaaaacatagaagaagccctgaaatacacttttgctttggaagaaatgtgc
caggtaacctatctggctcgtatcctcaagaaagctgactaa

DBGET integrated database retrieval system