KEGG   Dehalococcoides mccartyi BTF08: btf_1581Help
Entry
btf_1581          CDS       T02475                                 

Definition
class II aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
dmc  Dehalococcoides mccartyi BTF08
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:dmc00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1450787..1451368
Genome map
AA seq 193 aa AA seqDB search
MNGQTPSETLHWFIQAGKLLFGRGLVSSHSGNLSQRWKDKLYITRTGSSLPLFSETDLIL
TGLDHNDQFTPLASSELPVHRAIYRRTSAKAIVHAHPPYAAALSLLEGEIIPDCGEGLYC
LGAIPVIGFGERVHPGSLAEAVATALETHRVIVVAGHGSFATGENIEEALKYTFALEEMC
QVTYLARILKKAD
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
ttgaacggtcaaacaccttctgaaaccctgcattggtttatacaggctggaaaactgctt
ttcgggcggggactggtttcctcacactccggcaacctcagccaacgatggaaagacaag
ctttacataacccgaaccggcagttcactgcctctttttagcgaaacagacctgatactg
accggtcttgaccataatgaccagtttaccccgcttgcctcaagcgaactgcccgttcac
cgggctatttaccgccgcacatccgccaaagccatagttcatgctcacccgccttatgcg
gccgctctctccctgcttgagggggaaataataccggactgcggtgaggggctttactgc
ctgggagctataccggttatcggtttcggagagcgggttcatcccggcagtctggcagaa
gcagtggctacagcactggaaacacaccgggttatagtggtagccggtcatggcagcttt
gcaacaggggaaaacatagaagaagccctgaaatacacttttgctttggaagaaatgtgc
caggtaacctatctggctcgtatcctcaagaaagctgactaa

DBGET integrated database retrieval system