KEGG   Dehalococcoides mccartyi BTF08: btf_573Help
Entry
btf_573           CDS       T02475                                 

Definition
histone acetyltransferase, ELP3 family
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
dmc  Dehalococcoides mccartyi BTF08
Brite
Enzymes [BR:dmc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     btf_573
Transfer RNA biogenesis [BR:dmc03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    btf_573
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
542939..544318
Genome map
AA seq 459 aa AA seqDB search
MKKLSRTISGVTPVAVMTKPLPCPGKCIYCPTFAATPQSYTPESPAVLRAKSCEYQAYKQ
VALRLRIIQDMGHPTDKVELIIMGGTFLSADITYQYGFIKDCYDALNGVVAGSLEEAKTI
NETAQHRCVGLCIETRPDICGKAEIQRMIDFGTTRVELGVQMLDDDIYKLVERGHRVSDV
AEATCLLREYGLKVHYHWMPGLPGSSPEKDLALSRMVFEDPRFCPDGLKLYPTMVVEGTI
LEQWWKEGRYTPYPNGTMTGLIADIKALVPPYVRISRVLRDIPAVFISAGLKDSLRDGVR
QILESRHQKCRCIRCREYGHRQRKGQTSGEPTLRRLDYPASGGKEIFLSFEDVSDTLYGL
LRLRIPCASLPVLGQKYGAKTGLVRELHVYGTELSLGEQGDQSAQHRGLGRKLLAEAECL
ARDEFGLDSLAILSGVGAREYYRSLGYELVAGYMCKHLD
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagctttcccgaacaatatcaggtgttaccccggtggcggttatgaccaagccg
ctaccatgccccggcaagtgcatttattgccccacttttgccgctactccccaaagctat
acacctgaatctccggctgttttgcgggctaaaagctgtgaataccaggcttataaacag
gttgcccttcgcctgaggataatacaggacatgggacaccctacggataaggttgagctt
ataatcatgggtggcactttcctttcggcagatatcacttaccagtacggctttattaaa
gattgctacgacgctttgaacggagtggtggccggcagtctggaagaagccaaaaccata
aatgaaaccgcccagcaccgctgtgtgggtttatgtattgaaacccgtccggatatttgc
gggaaggccgaaatacaacggatgatagatttcgggactaccagagtggaacttggcgtc
cagatgctggatgatgatatttataagctggttgaacggggacatagggtttcagatgtg
gctgaggctacgtgtcttctgcgtgaatacggccttaaagtgcattaccactggatgccc
ggacttcccggctcttctcctgaaaaagatctggcactttcccggatggtgtttgaagac
ccgcggttttgccctgacgggcttaagctttatcccactatggtagtggaaggaactata
ctagaacagtggtggaaagagggaaggtacaccccctatcccaatggcaccatgaccggg
ctgattgcggatatcaaagcactggtgccgccttacgtgcgtatttcacgggtacttcgg
gatataccggctgtatttattagcgccggcctcaaagactccctgagggacggggttcgc
cagatactggaaagccgccaccagaagtgcaggtgcatacgttgccgtgaatacggccac
cgccagcggaaagggcagaccagcggtgaacctaccttaaggcgtcttgattatcctgcc
tcaggtggcaaggagatattccttagctttgaagatgtctctgacactctgtatggtctg
ctcagattgcgtataccctgtgcatcgctgcctgttctgggtcagaaatatggtgctaaa
acagggctggtgcgtgaactgcatgtgtatggcacagaactttcacttggggaacaggga
gaccagtctgcccagcaccggggtcttggacggaaactgctggcggaagcggagtgttta
gcccgtgatgaattcggtcttgactcactggctattttaagcggggtgggtgccagagag
tattacaggtcactggggtatgaactggtggctgggtatatgtgcaagcacttagactga

DBGET integrated database retrieval system