KEGG   Dehalococcoides mccartyi DCMB5: dcmb_1141Help
Entry
dcmb_1141         CDS       T02476                                 

Gene name
proB
Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
dmd  Dehalococcoides mccartyi DCMB5
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:dmd01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:dmd00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1091427..1092548
Genome map
AA seq 373 aa AA seqDB search
MNENCYKRVVIKLGTSLLTGGTGKLDHERMADLCRQIAELTRLGTEIVIVSSGAIAAGRS
KMGIRHLPKDVPFKQVLAAIGQSQLMNYYDQLFSPHGLTVAQGLLTKSDLSDRSGYLNAR
NTLLALMELGVITIVNENDVVAIDEIQQAKFGDNDNLSAMVANLIEADLLLILTNIRGLY
TSDPTLHPEATLITEVKEITEELEQLAAGSSNKLGTGGMVTKLEAARLATSSGVTAIIAD
GHIPDIILKLANGENEGTRFIPSLHKPDSRQRWMMSGLCTRGSICVDDGAAKALRENQKS
LLAAGVQQAEGKFGRGDIVKLTDSHGKRLGYGITNYSSDDISKIKGLHSQELNAVLGGNQ
GPEVIHRNNLVVI
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaaaattgttataaacgggttgtaataaagttgggcaccagtctgctcaccggc
ggcacaggcaagcttgaccatgagcgcatggctgacctgtgccgacagatagccgaactg
acccgcctgggtactgagatagttatagtttcttcgggggctattgccgccggacgctct
aaaatgggtatccgccaccttccgaaagatgttccttttaaacaagtgctggccgccata
ggccagagccagcttatgaattattatgaccagttattcagtcctcacgggctgacggtt
gcccaaggtctgctgaccaaaagtgacctgtctgaccgttcgggttacctcaacgcccga
aataccctgctggctttgatggaactgggagttataaccattgtcaatgaaaatgacgtg
gtagcaatagatgaaatccagcaagccaaatttggggataatgacaatctgtcggccatg
gtagccaacctgatagaggctgatttactgctgatactgaccaatatccgcgggctttac
acctcagaccctactctccaccctgaagctaccctgataaccgaggtcaaagagattacc
gaagaactggagcaactggccgccggcagctcaaacaagctgggtacaggcggaatggta
accaaactggaagccgccagactggccacatcttcaggagtaaccgccattattgcagac
gggcatataccggatattattctcaaactggcgaatggtgaaaatgaaggtacccgtttt
ataccttcactgcacaagccggatagccgccagcgctggatgatgagcgggctttgcacc
cgcggcagcatctgtgtagatgacggggcagccaaagcactaagagaaaaccagaaaagc
ctgctggctgccggagtgcaacaggccgaaggcaaattcgggcggggtgatattgtaaag
cttaccgacagccacggaaaacggctgggttatggcataaccaattactcttcagatgat
atttccaaaataaaaggccttcactcacaggaactaaacgccgttttagggggcaaccaa
ggccctgaagtaatacaccgcaataatctggtggtaatttaa

DBGET integrated database retrieval system