KEGG   Dehalococcoides mccartyi DCMB5: dcmb_619Help
Entry
dcmb_619          CDS       T02476                                 

Definition
histone acetyltransferase, ELP3 family
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
dmd  Dehalococcoides mccartyi DCMB5
Brite
Enzymes [BR:dmd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     dcmb_619
Transfer RNA biogenesis [BR:dmd03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    dcmb_619
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
608389..609768
Genome map
AA seq 459 aa AA seqDB search
MKKLSRTISGVTPVAVMTKPLPCPGKCIYCPTFAATPQSYTPESPAVLRAKSCEYQAYKQ
VALRLRIIQDMGHPTDKVELIIMGGTFLSADITYQYGFIKDCYDALNGVVAGSLEEAKTI
NETAQHRCVGLCIETRPDICGKAEIQRMIDFGTTRVELGVQMLDDDIYKLVERGHRVSDV
AEATCLLREYGLKVHYHWMPGLPGSSPEKDLALSRMVFADPRFCPDGLKLYPTMVVEGTI
LEQWWKEGRYTPYPNGTMTGLIADIKALVPPYVRISRVLRDIPAVFISAGLKDSLRDGVR
QILESRHQKCRCIRCCEYGHRQRKGQTSGEPTLRRLDYPASGGKEIFLSFEDVSDTLYGL
LRLRIPCASLPVLDQKYGAKTGLVRELHVYGIELSLGEQGDQSAQHRGLGRKLLAEAERL
ARDEFGLDSLAILSGVGAREYYRSLGYELVAGYMCKHLD
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagctttcccgaacaatatcaggtgttaccccggtggcggttatgaccaagccg
ctaccatgccccggcaagtgcatttattgccctacttttgccgctactccccaaagctat
acacctgaatctccggctgttttgcgggctaaaagctgtgaataccaggcttacaaacag
gttgcccttcgcctgaggataatacaggatatgggacaccctacggataaggttgagctt
ataatcatgggtggcactttcctttcggcagatatcacttaccagtacggctttattaaa
gattgctacgacgctttgaacggagtggtggccggcagtctggaagaagccaaaaccata
aatgaaaccgcccagcaccgctgtgtgggtttatgtattgaaacccgtccggatatttgc
gggaaggccgaaatacaacggatgatagatttcgggactaccagagtggaacttggcgtc
cagatgctggatgatgatatttataagctggttgaacggggacatagggtttcagatgtg
gctgaggctacgtgtcttctgcgtgaatacggccttaaagtgcattaccactggatgccc
ggacttcccggctcttctcctgaaaaagatctggcactttcccggatggtgtttgcagac
ccgcggttttgccctgacgggcttaagctttatcccactatggtagtggaaggaactata
ctagaacagtggtggaaagagggaaggtacaccccctatcccaatggcaccatgaccggg
ctgattgcggatatcaaagcactggtgccgccttacgtgcgtatttcacgggtacttcgg
gatataccggctgtatttattagcgccggcctcaaagactccctgagggacggggttcgc
cagatactggaaagccgccaccagaagtgcaggtgcatacgttgctgtgaatacggccac
cgccagcggaaagggcagaccagcggtgaacctaccttaaggcgtcttgattatcctgcc
tcaggtggcaaggagatattccttagctttgaagatgtctctgacactctgtatggtctg
ctcagattgcgtataccctgtgcatcgctgcctgttcttgatcagaaatatggtgctaaa
acagggctggtgcgtgaactgcatgtgtatggcatagagctttcactaggggaacaggga
gaccagtctgcccagcaccggggtcttggccggaaactgctggcggaagcggagcgttta
gcccgtgatgaattcggtcttgactcactggctattttaagcggggtgggtgccagagag
tattacaggtcactggggtatgaactggtggctgggtatatgtgcaagcacttagactga

DBGET integrated database retrieval system