KEGG   Dehalococcoides mccartyi DCMB5: dcmb_679Help
Entry
dcmb_679          CDS       T02476                                 

Definition
ribokinase family protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
dmd  Dehalococcoides mccartyi DCMB5
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:dmd00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    dcmb_679
Enzymes [BR:dmd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     dcmb_679
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(669004..669990)
Genome map
AA seq 328 aa AA seqDB search
MTTCSLEAIGLGAVHVDHIYTVEQILHDGECVVTESASFPGGSGANTIHGLSRLGLKCGF
IGAVGNDSDGNLLIKDFENAGIDNQYLMVTDEAQTGSVVSLSESSGRRSTYVNPGANNYL
NLSDINLEYLSQAKLVHMSTFFSQNEFALCHEIAERLAPDVLFSFSPGALFAAQGLKRLA
PILSRTNALFTNQLDIEKMTQKNYQRATDMCIRSGCEHVVVTLGESRRFQRKGKITLQTY
IRDKDHECHMESTVSLRKDIRTVVDTIGAADAFTTGFLFGLMGDKPIEECGLLGDISARF
CISKLGARSGLPNLEGLKERFGMHYFTN
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgactacttgtagtcttgaggctatcggcttgggggcggtgcatgtagatcatatatat
actgtggagcaaatactccatgacggcgaatgtgtagtcaccgaatctgcctcattcccc
ggcggttcaggtgcaaatactatacatgggttatcccggctgggattaaaatgcggcttc
ataggagcagtggggaatgactctgacggcaacctgttgattaaagactttgaaaacgca
ggtatagataaccagtacctgatggtaacggacgaagcccaaacgggctcagtggtttca
ctaagtgaatcttccgggcgccgctcaacatatgtaaatcccggtgccaacaattacctt
aacctttctgatatcaatctagagtacttaagccaagccaagctggttcatatgtcaact
ttcttcagccagaatgaatttgccctttgccatgaaatagcggaacggctggcaccggat
gtacttttcagcttttcacccggagccctctttgccgcccaggggctgaaaaggcttgct
cccattctttcacgcacaaatgcccttttcaccaaccaactggatatagagaaaatgacc
caaaagaattatcagcgggctacggatatgtgtatccgcagcggatgtgaacatgtggta
gttactctgggagagagccgccgttttcaacgaaaaggcaaaataaccctccagacctat
atacgggacaaagaccacgagtgccatatggagtcaaccgtcagcctcaggaaagatatc
cgtaccgtagtggatacaataggtgcggcagatgcctttaccaccggtttccttttcggg
cttatgggggataaacccattgaagagtgcggcttgctgggggatatttctgcccgtttc
tgcataagcaagctgggtgcccgttcaggtttgcccaatctggaagggctaaaagaacgt
ttcggcatgcactattttactaactga

DBGET integrated database retrieval system