KEGG   Drosophila melanogaster (fruit fly): Dmel_CG10033Help
Entry
Dmel_CG10033      CDS       T00030                                 

Gene name
for
Definition
foraging (EC:2.7.11.- 2.7.11.12)
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
Enzymes [BR:dme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     Dmel_CG10033 (for)
Protein kinases [BR:dme01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   Dmel_CG10033 (for)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L:24A2-24A4; 2L:2-10 cM
AA seq 934 aa AA seqDB search
MKIKHYPGKAVDASLSLEGSSAMGALYEANWLRAANQPAAPATTGTKLSRQSSSAGSSFL
IEGISALSKYQMTLENIRQLELQSRDKRIASTIKELSGYRPSALQHHQQQQMHNVWVAED
QDQEHEELEDASEGKEKLASIQEPPAVNHYVLDPTERPRVPRPRQQFSVKPPSLRRSQTM
SQPPSYATLRSPPKIKENLSKSSSAYSTFSSAAEDSQDQVVICQQPQRLMAPPPREPPPE
PPKRVSKPLSRSQTSVQRYATVRMPNQTTSFSRSVVRSRDSTASQRRLSLEQAIEGLKLE
GEKAVRQKSPQISPAASSNGSSKDLNGEGFCIPRPRLIVPVHTYARRRRTGNLKEQSSGG
QEEEAEKGKGWKDFYVLSQDRHSSFYINRIGQNYDYDYPINFNIFSPDGRVEVSREGKYL
STLSGAKVLGELAILYNCQRTATITAITECNLWAIERQCFQTIMMRTGLIRQAEYSDFLK
SVPIFKDLAEDTLIKISDVLEETHYQRGDYIVRQGARGDTFFIISKGKVRVTIKQQDTQE
EKFIRMLGKGDFFGEKALQGDDLRTANIICESADGVSCLVIDRETFNQLISNLDEIKHRY
DDEGAMERRKINEEFRDINLTDLRVIATLGVGGFGRVELVQTNGDSSRSFALKQMKKSQI
VETRQQQHIMSEKEIMGEANCQFIVKLFKTFKDKKYLYMLMESCLGGELWTILRDKGNFD
DSTTRFYTACVVEAFDYLHSRNIIYRDLKPENLLLNERGYVKLVDFGFAKKLQTGRKTWT
FCGTPEYVAPEVILNRGHDISADYWSLGVLMFELLTGTPPFTGSDPMRTYNIILKGIDAI
EFPRNITRNASNLIKKLCRDNPAERLGYQRGGISEIQKHKWFDGFYWWGLQNCTLEPPIK
PAVKSVVDTTNFDDYPPDPEGPPPDDVTGWDKDF
NT seq 2805 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcaaacattatccgggcaaagccgtcgatgcgagtctctcgctggagggcagc
agtgccatgggtgccctgtacgaggccaattggctgagggctgcgaatcagcccgccgct
ccagccacaacgggcaccaaattgagcaggcagagcagctccgccggcagcagtttcctc
atcgagggcatctccgccctgagcaagtaccaaatgaccctggagaatatccggcagctg
gagctgcagtcgcgtgacaaacgcatagcgagcacgattaaggaactcagcggctatagg
ccatcggcactgcagcatcatcagcagcagcagatgcataacgtttgggtggccgaggat
caggatcaggaacacgaagaactggaagatgcttcggagggaaaggagaagttggctagt
atccaggaaccccctgcagttaaccactatgtcctggacccgacggagagaccaagggtt
cccagaccccggcaacagttctccgtgaaaccgccttccttgcgtcgctcccaaaccatg
tcgcaaccgcccagttatgccaccttgagatcgcccccgaaaatcaaggaaaatcttagc
aaaagttcctccgcctactccacattctcctcggctgcagaggattcccaggatcaagta
gtgatctgccaacagccacagagactgatggctccgccacccagagaaccgcctccggag
ccacccaaaagggtatcgaaacccctgagcagatcgcaaacttcggttcagcggtacgcc
acggttaggatgcccaaccagaccacttcgttcagcagaagtgtggtcaggtctagggat
tccaccgcctcccagagacgtctcagtttggagcaggccatcgagggactcaaactggag
ggggagaaggctgttcgtcagaagagtccacaaatctcaccagctgccagcagtaatggc
agctccaaggatctcaacggggagggtttctgtatcccacgaccgcgcctcatcgttcca
gtgcacacatatgcccgtcgacgcaggacgggaaatctcaaggagcaatccagcggtggg
caggaggaggaagcagagaagggtaaggggtggaaggatttctatgttttaagtcaggat
aggcatagtagcttttatatcaataggataggacagaattatgattatgattacccaatt
aattttaatatattttctccagatggacgcgtggaggtttcccgcgagggcaagtacctc
tccacattgtcgggagcgaaggtccttggcgaattggcgatcctgtacaactgccagcgg
acggcgaccatcaccgcgatcaccgagtgcaacctgtgggccatcgagcgccagtgcttt
cagaccatcatgatgcgaacgggcctgatccggcaggcggagtacagcgatttcctcaag
agtgtgcccatcttcaaagacctggcggaagacacgctcatcaaaatctccgatgttttg
gaggagacgcactaccagcgtggcgactacatagtgcgccaaggcgcccgaggcgatacc
ttcttcatcatatccaagggaaaagtgcgagtgacgatcaagcagcaggacacgcaggag
gagaagttcattcgcatgctgggcaaaggggatttctttggagagaaggctctccagggc
gatgatctgcgcacggcgaatattatttgcgagtccgccgatggcgtcagttgtctggtc
atcgatcgcgagaccttcaatcagctaatttccaatctagacgagatcaagcatcgctac
gacgacgagggcgccatggaacgcagaaagatcaacgaggaattccgggacattaacctc
acagatctgcgcgtcatcgcaacccttggagttggaggcttcggtcgcgtagagctggtc
caaactaatggagatagctccaggtccttcgcgctcaagcagatgaaaaagtcacagatt
gtggagacgcgtcagcagcaacacatcatgtccgagaaggagatcatgggcgaggccaat
tgccagttcatcgtgaagctgttcaagaccttcaaggacaagaagtacctgtacatgctg
atggagagttgcctgggcggagagctctggacgattctacgggacaagggcaacttcgac
gacagcaccacccgcttctacacggcatgtgtggtggaggcctttgattacttgcactcg
cgtaacatcatctaccgcgatcttaagccggagaacctgctgctcaatgaacgaggatat
gtgaagctggtggactttggctttgccaagaagctgcagacgggcaggaagacctggact
ttctgcggcactccagagtacgtggctcccgaggtgattctcaaccggggccacgacatc
agtgcggattactggtcgctgggagtgctcatgttcgagttacttactggtacccctcca
ttcacgggctcggatcccatgcgcacctacaacattatacttaagggcatcgacgccatc
gaattcccaaggaatatcacccgcaatgccagcaacctgatcaagaagctctgtcgcgac
aatccagccgagcgtttgggctaccagcgtgggggaatcagcgagatccaaaagcacaaa
tggttcgatggcttctattggtggggcctgcagaactgcacactggaaccgcccattaag
cccgccgtgaaaagcgttgtggatacaacaaactttgatgactatcctcccgatcctgag
ggtccgccgccagatgatgtcactggatgggacaaggacttctga

DBGET integrated database retrieval system