KEGG   Drosophila melanogaster (fruit fly): Dmel_CG1004Help
Entry
Dmel_CG1004       CDS       T00030                                 

Gene name
rho
Definition
rhomboid (EC:3.4.21.-)
Orthology
K02857  
rhomboid-related protein 1/2/3 [EC:3.4.21.105]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Dorso-ventral axis formation
Brite
KEGG Orthology (KO) [BR:dme00001]
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    Dmel_CG1004 (rho)
Enzymes [BR:dme01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.105  rhomboid protease
     Dmel_CG1004 (rho)
Peptidases [BR:dme01002]
 Serine Peptidases
  Family S54: Rhomboid family
   Dmel_CG1004 (rho)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L:62A2-62A2; 3L:3-0.2 cM
AA seq 355 aa AA seqDB search
MENLTQNVNETKVDLGQEKEKEASQEEEHATAAKETIIDIPAACSSSSNSSSYDTDCSTA
SSTCCTRQGEHIYMQREAIPATPLPESEDIGLLKYVHRQHWPWFILVISIIEIAIFAYDR
YTMPAQNFGLPVPIPSDSVLVYRPDRRLQVWRFFSYMFLHANWFHLGFNIVIQLFFGIPL
EVMHGTARIGVIYMAGVFAGSLGTSVVDSEVFLVGASGGVYALLAAHLANITLNYAHMKS
ASTQLGSVVIFVSCDLGYALYTQYFDGSAFAKGPQVSYIAHLTGALAGLTIGFLVLKNFG
HREYEQLIWWLALGVYCAFTVFAIVFNLINTVTAQLMEEQGEVITQHLLHDLGVS
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggagaacttaacgcagaatgtaaacgaaaccaaggtggatttgggccaggagaaggag
aaggaggcgtcgcaggaggaggagcatgccaccgccgccaaggagaccatcattgacatt
cccgccgcgtgctccagttcctccaactcctcgtcgtacgacaccgattgcagcacggcg
agcagcacctgctgcacccgccaaggcgagcacatctacatgcaacgcgaggccatcccg
gccacgccacttccggagtcggaggatatcggcctgctgaagtacgtccaccgccagcac
tggccctggttcatcctagtgatctccatcattgagattgccatcttcgcctacgaccgc
tacacaatgcccgcccagaatttcgggctacccgttccgattccgtcggattcggtgctg
gtctatcggccggaccggcgtctgcaggtgtggcgcttctttagctacatgttcctgcac
gccaactggttccacctgggcttcaatatcgtcatccagctgttttttggcattcccctg
gaggtgatgcacggcacggccaggatcggcgtgatctacatggcgggcgtttttgccgga
tccctgggcaccagtgtcgtcgactcggaggtcttcctggtgggcgccagcggtggcgtc
tatgccctgttggccgcacatctggccaacattacactgaactatgcgcacatgaagagc
gcatccacgcaactcggatccgttgtcatctttgtctcctgcgatctgggctatgctctc
tacacccaatacttcgatggaagcgccttcgccaagggtccccaggtgtcgtacattgcc
cacctgacgggagccctggcaggactaacgatcggctttctggtgctaaagaacttcggt
caccgagagtacgagcagctcatctggtggctagcgttgggcgtctactgtgccttcacc
gtcttcgccatcgttttcaacctgatcaacacggtgaccgctcagctgatggaggagcag
ggtgaggtgattacccagcatctgttgcacgacctgggagtgtcctaa

DBGET integrated database retrieval system