KEGG   Drosophila melanogaster (fruit fly): Dmel_CG10076Help
Entry
Dmel_CG10076      CDS       T00030                                 

Gene name
spir
Definition
(RefSeq) spire
  KO
K02098  
spire
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Dorso-ventral axis formation
Brite
KEGG Orthology (KO) [BR:dme00001]
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    Dmel_CG10076 (spir)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Structure
PDB: 

Jmol
Position
2L:38C5-38C5; 2L:2-54 cM
AA seq 1020 aa AA seqDB search
MTEHQAEEQADTPPTKVKATPTPTPSGKFKDAKEDAFLSTSPDSANGDAQHKLPADQLAM
SSSAHPQQAGQARPLILQAFHRCSSPEQCVTLHDILDSFKAPLSEDQAWALIHQFAGLYH
QVAVQAHTCAADYEAALPTGFELHFHRDGSVHFSGPDQLTPKEQLQQEQIPLPPQHDVIV
DQPDHSASSSGDSSVINRAFDNSNHHHHHQHHHPPLVVSHRKIISELAEIVYTALDYNLP
EDEECQVSQELENLFNFMTADETDDDCIDEGIDEGDKRWDDESEEERNDTKELEHIIETC
RNHIKTTLPENHYRAVCRALVTETIELRVFLQQVLNNEAGAEKLIKASESSATTQQELAK
LGFNDWARFWVQVIDELRRGVRLKKSNHERTPIEYELTPYEILMGDIRAKKYQLRKVMVN
GDIPPRVKKDAHAMILEFIRSRPPLKKASDRQLGPPRMCEPSPREQLMESIRKGKELKQI
TPPEAPTLRERVLPSANSTLSRSRQRLIKVDFSKFQDDDLFYDENSISSSHSTAATHQHH
PHFAEMHRCSQPKMPPYPFGGYMVPSQARQDCRETASLMRPRRTMEPAKQVPPPEEPSFT
KDEYHKFYDTALESYDLATQCESRRASLRRHTIVGCQSNLDETHSMPPTRPESRQSDDVS
KETPKRSPAEQTHPSDEGSSTSSLGPWNKSFMDKQTWMERGDDRLSVTLAEIVHIRSVMT
KAELEGLPMDVRVKEDVEKRRVCFLCLRTRFSFFGPWGIQCKLCQRTVCAKCYTKMRIPS
EHFRNVPLVLISPSLLSSPASSSTPSPSHHAQQAHSSSTGNIMDDQFPKSLIERLLRSES
DRKTRSTVGSAPSSPKHQRSNMSTPGISVGPGASSSSAAATGQAVEALHDQATMSSSYSA
AMRPSGVHQQQKQHYNNAMSRSMEGPRSLPVHSPAYRPLSNNSTLERKSRFSRGFNLFSS
GSHLAQTQEQKENLRGEQVTVCNDCQGLVNEITSSVKQKRSSARNRTIQNLTLDLTPVWK
NT seq 3063 nt NT seq  +upstreamnt  +downstreamnt
atgacggagcaccaggccgaggagcaggcggacacgccgcccaccaaggtcaaggccacg
cccacacccaccccgagtggaaagttcaaggacgcgaaggaagacgccttcctgtccaca
tcgccggacagcgccaacggcgatgcccaacacaagctgccagcggaccagctggccatg
tcctccagtgcgcatccccagcaggcgggccaagcccgcccgctcatcctgcaagccttc
caccgctgctcctcgccagaacagtgcgtcacgctgcacgacatcctggactcctttaag
gcgccgctctccgaggaccaggcctgggccctgatccaccagttcgccgggctctaccac
caggtggccgtacaagcgcacacctgtgccgcggactacgaggccgccctgcccaccgga
ttcgagctgcacttccatcgcgacggcagcgtccacttctccggcccggatcagctgacg
cctaaggagcaactgcagcaggagcagatccccctccccccgcagcacgacgtgattgtg
gatcagccggaccacagcgccagcagcagcggcgacagcagcgtcatcaacagagcgttc
gacaacagcaatcaccaccaccaccatcaacatcatcacccgccgctcgtcgtctcgcat
agaaagattatcagcgaactggcggaaatcgtctacaccgccttggattacaatctgccg
gaggacgaggagtgccaagtgtcacaggagctggagaatctgttcaactttatgacggca
gatgagacagacgacgattgcattgacgagggcatcgacgagggcgacaagcgctgggac
gacgaatccgaggaggagcgcaacgataccaaagaactagagcacataatcgagacctgc
agaaatcacataaaaaccaccctgcctgagaaccactatagagctgtctgcagagccctc
gtgacggagaccatagagctccgagtatttctgcagcaggtcctgaacaatgaagcaggt
gccgagaaactgatcaaggcgtcggaatcatcggccaccacgcaacaagaactggcgaag
ctgggcttcaacgactgggcacgcttctgggtgcaggtgatcgacgaactgcgacgggga
gtgcggctgaagaagagcaaccacgagcgcactcccatcgaatatgagctgacaccctac
gaaatactcatgggcgacatccgagccaaaaagtatcagttgcgcaaggtgatggtcaac
ggagatattccgccgcgcgtcaagaaagatgcccacgccatgatcttggagttcatcagg
tcacggccgccgctgaagaaggccagcgatcgccaattgggcccgccgcgcatgtgcgag
ccttctccgcgggagcagctcatggagtccatacggaaggggaaggagctcaagcagatc
accccgccagaagcaccgaccctcagggaaagggtgcttccaagtgcaaactccacgctg
tcacgatccagacagcggctcatcaaagtggacttctccaagtttcaggacgacgatctc
ttctacgatgagaacagcatcagcagctcccactccacagcggccacccaccagcatcat
ccacatttcgccgagatgcaccgctgctcgcagcccaagatgccgccgtatccattcggt
ggctacatggtgcccagtcaggcacgacaagattgccgggagacggcgtcgctgatgcgg
ccccgacgcacaatggagccagcaaagcaggtgccgcctccagaagagccatccttcacg
aaggacgagtaccacaagttctacgacacggccctggaatcctacgacctggccactcag
tgcgagtcgaggagggcttccttgcgccgccacaccatcgttggatgccagagcaacctg
gacgagacgcactcaatgccgcccacgcggcccgagtcgcgtcaatcggacgacgtcagc
aaggagacgcctaagagaagtcctgcggagcagacccatccctcagacgagggcagttca
acatcctcgcttgggccatggaacaagtccttcatggacaaacagacgtggatggaacgg
ggtgacgatcggctgtccgtaacgctggcggagatcgttcacatccgttccgtcatgacc
aaggcggagctggagggcctgccgatggacgtgcgcgtcaaggaggatgttgaaaagcgt
cgcgtctgcttcctgtgcctgcgcactcggttctcgttcttcggtccctggggcattcag
tgcaagttgtgccagcgcacggtctgcgccaagtgctataccaagatgcgaattccctcg
gagcacttccgaaacgtgcccctcgtgctgatctcgccatcgctgctgtccagtccggcc
agctcgagcaccccatcaccctcccatcatgcccagcaggcgcactcatcctcgacgggg
aacatcatggacgaccagttccccaagtcgttgatagagcgtcttttgcgctccgagtca
gatcgaaagactcgcagcactgtgggcagtgccccatcctcacccaagcaccaaagatca
aacatgagcacgcccggcattagcgtgggacccggagcatcctcctcctcagcggccgcc
actggacaggccgtggaggcactgcacgaccaggcgaccatgtcgtcctcgtattccgcg
gccatgcgaccctctggcgtccaccagcagcagaagcagcactacaacaacgccatgtcg
aggagcatggagggaccccgaagtctgcccgtgcacagtccagcatatcgaccgctctcc
aataacagcaccttggagaggaaatcccgcttttcgaggggattcaacctgttctcctcg
ggcagccatcttgcccagacgcaggagcaaaaggagaacctgcgcggcgagcaggtgacc
gtgtgcaacgactgccagggactggtcaacgagatcacgagctccgtgaagcagaagcgc
agctccgcacggaaccgcaccattcagaatctcaccctggatctgacgcccgtctggaag
tag

DBGET integrated database retrieval system