KEGG   Drosophila melanogaster (fruit fly): Dmel_CG10079Help
Entry
Dmel_CG10079      CDS       T00030                                 

Gene name
Egfr
Definition
Epidermal growth factor receptor (EC:2.7.10.-)
Orthology
K04361  
epidermal growth factor receptor [EC:2.7.10.1]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
MAPK signaling pathway - fly
FoxO signaling pathway
Endocytosis
Dorso-ventral axis formation
Brite
KEGG Orthology (KO) [BR:dme00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    Dmel_CG10079 (Egfr)
   04068 FoxO signaling pathway
    Dmel_CG10079 (Egfr)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    Dmel_CG10079 (Egfr)
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    Dmel_CG10079 (Egfr)
Enzymes [BR:dme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     Dmel_CG10079 (Egfr)
Protein kinases [BR:dme01001]
 Tyrosine protein kinases
  EGFR family [OT]
   Dmel_CG10079 (Egfr)
Exosome [BR:dme04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Dmel_CG10079 (Egfr)
  Exosomal proteins of pancreatic cancer cells
   Dmel_CG10079 (Egfr)
  Exosomal proteins of bladder cancer cells
   Dmel_CG10079 (Egfr)
Enzyme-linked receptors [BR:dme01020]
 Receptor tyrosine kinases
  RTK class I (EGF receptor family)
   Dmel_CG10079 (Egfr)
Cytokine receptors [BR:dme04050]
 Receptor tyrosine kinase
  RTK class I (EGF receptor family)
   Dmel_CG10079 (Egfr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Structure
PDB: 

Jmol
Position
2R:57E9-57F1
AA seq 1377 aa AA seqDB search
MMIISMWMSISRGLWDSSSIWSVLLILACMASITTSSSVSNAGYVDNGNMKVCIGTKSRL
SVPSNKEHHYRNLRDRYTNCTYVDGNLELTWLPNENLDLSFLDNIREVTGYILISHVDVK
KVVFPKLQIIRGRTLFSLSVEEEKYALFVTYSKMYTLEIPDLRDVLNGQVGFHNNYNLCH
MRTIQWSEIVSNGTDAYYNYDFTAPERECPKCHESCTHGCWGEGPKNCQKFSKLTCSPQC
AGGRCYGPKPRECCHLFCAGGCTGPTQKDCIACKNFFDEGVCKEECPPMRKYNPTTYVLE
TNPEGKYAYGATCVKECPGHLLRDNGACVRSCPQDKMDKGGECVPCNGPCPKTCPGVTVL
HAGNIDSFRNCTVIDGNIRILDQTFSGFQDVYANYTMGPRYIPLDPERLEVFSTVKEITG
YLNIEGTHPQFRNLSYFRNLETIHGRQLMESMFAALAIVKSSLYSLEMRNLKQISSGSVV
IQHNRDLCYVSNIRWPAIQKEPEQKVWVNENLRADLCEKNGTICSDQCNEDGCWGAGTDQ
CLTCKNFNFNGTCIADCGYISNAYKFDNRTCKICHPECRTCNGAGADHCQECVHVRDGQH
CVSECPKNKYNDRGVCRECHATCDGCTGPKDTIGIGACTTCNLAIINNDATVKRCLLKDD
KCPDGYFWEYVHPQEQGSLKPLAGRAVCRKCHPLCELCTNYGYHEQVCSKCTHYKRREQC
ETECPADHYTDEEQRECFQCHPECNGCTGPGADDCKSCRNFKLFDANETGPYVNSTMFNC
TSKCPLEMRHVNYQYTAIGPYCAASPPRSSKITANLDVNMIFIITGAVLVPTICILCVVT
YICRQKQKAKKETVKMTMALSGCEDSEPLRPSNIGANLCKLRIVKDAELRKGGVLGMGAF
GRVYKGVWVPEGENVKIPVAIKELLKSTGAESSEEFLREAYIMASVEHVNLLKLLAVCMS
SQMMLITQLMPLGCLLDYVRNNRDKIGSKALLNWSTQIAKGMSYLEEKRLVHRDLAARNV
LVQTPSLVKITDFGLAKLLSSDSNEYKAAGGKMPIKWLALECIRNRVFTSKSDVWAFGVT
IWELLTFGQRPHENIPAKDIPDLIEVGLKLEQPEICSLDIYCTLLSCWHLDAAMRPTFKQ
LTTVFAEFARDPGRYLAIPGDKFTRLPAYTSQDEKDLIRKLAPTTDGSEAIAEPDDYLQP
KAAPGPSHRTDCTDEIPKLNRYCKDPSNKNSSTGDDETDSSAREVGVGNLRLDLPVDEDD
YLMPTCQPGPNNNNNINNPNQNNMAAVGVAAGYMDLIGVPVSVDNPEYLLNAQTLGVGES
PIPTQTIGIPVMGVPGTMEVKVPMPGSEPTSSDHEYYNDTQRELQPLHRNRNTETRV
NT seq 4134 nt NT seq  +upstreamnt  +downstreamnt
atgatgattatcagcatgtggatgagcatatcgcgaggattgtgggacagcagctccatc
tggtcggtgctgctgatcctcgcctgcatggcatccatcaccacaagctcatcggtcagc
aatgccggctatgtggataatggcaatatgaaagtctgcatcggcactaaatctcggctc
tccgtgccctccaacaaggaacatcattaccggaacctcagagatcggtacacgaactgt
acgtatgtggatggcaacctggagctgacctggctgcccaacgagaatttggacctcagc
ttcctggacaacatacgggaggtcaccggctatattctgatcagtcatgtggacgttaag
aaagtggtatttcccaaactacaaatcattcgcggacgcacgctgttcagcttatccgtg
gaggaggagaagtatgccttgttcgtcacttattccaaaatgtacacgctggagattccc
gatctacgcgatgtcttaaatggccaagtgggcttccacaacaactacaatctctgccac
atgcgaacgatccagtggtcggagattgtatccaacggcacggatgcatactacaactac
gactttactgctccggagcgcgagtgtcccaagtgccacgagagctgcacgcacggatgt
tggggcgagggtcccaagaattgccagaagttcagcaagctcacctgctcgccacagtgt
gccggaggtcgttgctatggaccaaagccgcgggagtgttgtcacctcttctgcgccgga
ggatgcactggtcccacgcaaaaggattgcatcgcctgcaagaacttcttcgacgagggc
gtatgcaaggaggaatgcccgcccatgcgcaagtacaatcccaccacctatgttcttgaa
acgaatcctgagggaaagtatgcctatggtgccacctgcgtcaaggagtgtcccggtcat
ctgttgcgtgataatggcgcctgcgtgcgcagctgtccccaggacaagatggacaagggg
ggcgagtgtgtgccctgcaatggaccgtgccccaaaacctgcccgggcgttactgtcctg
catgccggcaacattgactcgttccggaattgtacggtgatcgatggcaacattcgcatt
ttggatcagaccttctcgggcttccaggatgtctatgccaactacacgatgggaccacga
tacataccgctggatcccgagcgactggaggtgttctccacggtgaaggagatcaccggg
tatctgaatatcgagggaacccacccgcagttccggaatctgtcgtacttccgcaatctg
gaaacaattcatggccgccagctgatggagagcatgtttgccgctttggcgatcgttaag
tcatccctgtacagcctggagatgcgcaatctgaagcagattagttccggcagtgtggtc
atccagcataatagagacctctgctacgtaagcaatatccgttggccggccattcagaag
gagcccgaacagaaggtgtgggtcaacgagaatctcagggcggatctatgcgagaaaaat
ggaaccatttgctcggatcagtgcaacgaggacggctgctggggagctggcacggatcag
tgccttacctgcaagaacttcaatttcaatggcacctgcatcgccgactgtggttatata
tccaatgcctacaagtttgacaatagaacgtgcaagatatgccatccagagtgccggact
tgcaatggagctggagcagatcactgccaggagtgcgtccatgtgagggacggtcagcac
tgtgtgtccgagtgcccgaagaacaagtacaacgatcgtggtgtctgccgagagtgccac
gccacctgcgatggatgcactgggcccaaggacaccatcggcattggagcgtgtacaacg
tgcaatttggccattatcaacaatgacgccacagtaaaacgctgcctgctgaaggacgac
aagtgccccgatgggtacttctgggagtatgtgcatccacaagagcagggatcgctaaag
ccattggccggcagagcagtttgccgaaagtgccatcccctttgcgagctgtgcaccaac
tacggataccatgaacaggtgtgctccaagtgcacccactacaagcgacgagagcagtgc
gagaccgagtgtccggccgatcactacacggatgaggagcagcgcgagtgcttccagtgc
cacccagaatgcaacggttgcactggtccgggtgccgacgattgcaagtcttgtcgcaac
ttcaagttgttcgacgcgaatgagacgggtccctatgtgaactccacgatgttcaattgc
acctcgaagtgtcccttggagatgcgacatgtgaactatcagtacacggccattggaccc
tactgtgcagctagtccgccgaggagcagcaagataactgccaatctggatgtgaacatg
atcttcattatcactggtgctgttctggtgccgacgatctgcatcctctgcgtggtcaca
tacatttgtcggcaaaagcaaaaggccaagaaagaaacagtgaagatgaccatggctctg
tccggctgtgaggattccgagccgctgcgtccctcgaacattggagccaatctatgcaag
ttgcgcattgtcaaggacgccgagttgcgcaagggcggagtcctcggaatgggagccttt
ggacgagtgtacaagggcgtttgggtgccggagggtgagaacgtcaagattccagtggcc
attaaggagctgctcaagtccacaggcgccgagtcaagcgaagagttcctccgcgaagcc
tacatcatggcctctgtggagcacgttaatctgctgaagctcctggccgtctgcatgtcc
tcacaaatgatgctaatcacgcaactgatgccgcttggctgcctgttggactatgtgcga
aataaccgggacaagatcggctctaaggctctgctcaactggagcacgcaaatcgccaag
ggcatgtcgtatctggaggagaagcgactggtccacagagacttggctgcccgcaatgtc
ctggtgcagactccctcgctggtgaagatcaccgactttgggctggccaagttgctgagc
agcgattccaatgagtacaaggctgctggcggcaagatgcccatcaagtggttggcactg
gagtgcattcgcaatcgtgtattcaccagcaagtccgatgtctgggcctttggtgtgaca
atttgggaactgctgacctttggccagcgtccacacgagaacatccccgctaaggatatt
cccgatcttattgaagtcggtctgaagctggagcagccggagatttgttcgctggacatt
tactgcacacttctctcgtgctggcacttggatgccgccatgcgtccaaccttcaagcag
ctgactacggtctttgctgagttcgccagagatccgggtcgctatctggccattcccggg
gataagttcacccggctgccggcctacacgagtcaggatgagaaggatctcatccgaaaa
ttggctcccaccaccgatgggtccgaagccattgcggaacccgatgactacctgcaaccc
aaggcagcacctggtcctagtcacagaaccgactgcacggatgagatacccaagctgaac
cgctactgcaaggatcctagcaacaagaattcgagtaccggagacgatgagacggattcg
agtgcccgggaagtgggcgtgggtaatctgcgcctcgatctaccagtcgatgaggatgat
tacctgatgcccacatgccaaccggggcccaacaacaacaacaacataaataatcccaat
caaaacaatatggcagctgtgggcgtggctgccggctacatggatctcatcggagtgccc
gttagtgtggacaatccggagtatctgctaaacgcgcagacactgggtgttggggagtcg
ccgatacccacccagaccatcgggataccggtgatgggagtcccgggcaccatggaggtc
aaggtgccaatgccaggcagtgagccaacgagctccgatcacgagtactacaatgatacc
caacgggagttgcagccactgcatcgaaaccgcaacacggagacgagggtgtag

DBGET integrated database retrieval system